Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7124

Name

TNF

Synonym

DIF|TNF-alpha|TNFA|TNFSF2;tumor necrosis factor;TNF;tumor necrosis factor

Definition

APC1 protein|TNF superfamily, member 2|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|cachectin|tumor necrosis factor alpha|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Allograft rejection;KEGG PATHWAY;hsa05330

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

Type I diabetes mellitus;KEGG PATHWAY;hsa04940

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

TNF signaling;PID Reactome;500256

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Systemic lupus erythematosus;KEGG PATHWAY;hsa05322

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

tnfr1 signaling pathway;PID BioCarta;100015

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

visceral fat deposits and the metabolic syndrome;PID BioCarta;100004

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

Graft-versus-host disease;KEGG PATHWAY;hsa05332

Pathway

Cellular roles of Anthrax toxin;PID Curated;200179

Pathway

il-10 anti-inflammatory signaling pathway;PID BioCarta;100134

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

sodd/tnfr1 signaling pathway;PID BioCarta;100031

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Asthma;KEGG PATHWAY;hsa05310

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

tnf/stress related signaling;PID BioCarta;100026

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Granulomatous disease;FunDO

Disease

inflammatory bowel disease;GAD

Disease

Sjogren's syndrome;GAD

Disease

dermatitis herpetiformis.;GAD

Disease

Septic shock, susceptibility to;OMIM

Disease

Silicosis;FunDO

Disease

lep. Leprosy;GAD

Disease

beta-Thalassemia;GAD

Disease

Intermediate coronary syndrome;FunDO

Disease

Psoriasis;FunDO

Disease

Nasopharyngeal cancer;FunDO

Disease

Down syndrome;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

bronchiectatic disease;GAD

Disease

longevity;GAD

Disease

Excessive fat accumulation;GAD

Disease

Leprosy;FunDO

Disease

IMMUNE;GAD

Disease

Multiple myeloma;FunDO

Disease

meliodosis;GAD

Disease

COPD;GAD

Disease

pancreatitis;GAD

Disease

Polycystic ovary syndrome;FunDO

Disease

HIV disease;GAD

Disease

asthma, aspirin-intolerant;GAD

Disease

Mycoses;FunDO

Disease

Colon cancer;FunDO

Disease

Cervical cancer;FunDO

Disease

hepatitis B;GAD

Disease

cirrhosis, biliary primary;GAD

Disease

PSYCH;GAD

Disease

Obesity ?????????;GAD

Disease

irritant contact dermatitis;GAD

Disease

Bone mineral mass;GAD

Disease

Sarcoidosis;FunDO

Disease

hematopoietic stem cell transplantation;GAD

Disease

Basal cell carcinoma;FunDO

Disease

Renal Cell cancer;FunDO

Disease

pre-term delivery infant mortality and malaria morbidity;GAD

Disease

hepatitis, autoimmune;GAD

Disease

meningococcal disease.;GAD

Disease

carbamazepine hypersensitivity;GAD

Disease

synthetic hemodialysis graft failure;GAD

Disease

Enteritis;FunDO

Disease

Obesity- associated hypertension ???????;GAD

Disease

Polyendocrinopathies, Autoimmune;GAD

Disease

C-reactive protein;GAD

Disease

brucellosis;GAD

Disease

Arthritis, Rheumatoid;GAD

Disease

Infertility;FunDO

Disease

multiple sclerosis;GAD

Disease

malarial anemia and cerebral malaria;GAD

Disease

Atherosclerosis;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Muscular dystrophies;FunDO

Disease

allergic rhinitis;GAD

Disease

Subarachnoid Hemorrhage;GAD

Disease

Carcinoma, Hepatocellular;GAD

Disease

breast cancer;GAD

Disease

Alcoholic liver disease;FunDO

Disease

Graves' disease;GAD

Disease

Migraine;FunDO

Disease

Tuberous sclerosis;FunDO

Disease

recurrent pregnancy loss;GAD

Disease

ankylosing spondylitis;GAD

Disease

Liver cancer;FunDO

Disease

Malignant glioma;FunDO

Disease

Ulcerative colitis;FunDO

Disease

oral cancer;GAD

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

hypertension;GAD

Disease

Dermatitis;FunDO

Disease

Pancreatitis;FunDO

Disease

coal workers' pneumoconiosis (CWP);GAD

Disease

systemic inflammatory response syndrome;GAD

Disease

atherosclerosis, coronary;GAD

Disease

sclerosis, systemic;GAD

Disease

kidney transplant;GAD

Disease

silicosis;GAD

Disease

Histiocytosis;FunDO

Disease

fibrosing alveolitis;GAD

Disease

Systemic infection;FunDO

Disease

Dementia, vascular, susceptibility to;OMIM

Disease

malaria;GAD

Disease

Otitis media;FunDO

Disease

Kidney disease;FunDO

Disease

emphysema;GAD

Disease

allograft dysfunction, renal;GAD

Disease

sepsis;GAD

Disease

diabetes, type 1;GAD

Disease

lung function;GAD

Disease

myasthenia gravis;GAD

Disease

stroke, hemorrhagic stroke, ischemic;GAD

Disease

graft-versus-host disease;GAD

Disease

Kidney Failure, Chronic;GAD

Disease

AIDS progression;GAD

Disease

Systemic lupus erythematosus;KEGG DISEASE;H00080

Disease

Crohn's disease;GAD

Disease

Migraine without aura, susceptibility to;OMIM

Disease

chronic atrophic gastritis and gastric carcinoma;GAD

Disease

Necrotizing enterocolitis;FunDO

Disease

increased cardiopulmonary morbidity;GAD

Disease

Leishmania chagasi infection;GAD

Disease

Behcet syndrome;FunDO

Disease

Graft-versus-host disease;KEGG DISEASE;H00084

Disease

allograft outcome;GAD

Disease

chronic GVHD;GAD

Disease

acute renal allograft rejection;GAD

Disease

CANCER;GAD

Disease

schizophrenia;GAD

Disease

Amyloidosis;FunDO

Disease

Allergies and autoimmune diseases;KEGG DISEASE

Disease

contact hypersensitivity;GAD

Disease

Migraine Disorders;GAD

Disease

ulcerative colitis;GAD

Disease

Arthritis;FunDO

Disease

mucocutaneous leishmaniasis;GAD

Disease

Thyroid cancer;FunDO

Disease

HEMATOLOGICAL;GAD

Disease

endometriosis;GAD

Disease

cerebral malaria;GAD

Disease

Asthma;FunDO

Disease

Pancreas cancer;FunDO

Disease

Scarring trachoma;GAD

Disease

AGING;GAD

Disease

HIV infection;FunDO

Disease

cirrhosis;GAD

Disease

hypothyroidism;GAD

Disease

Prostate cancer;FunDO

Disease

Meningococcal Infections;GAD

Disease

Anemia;FunDO

Disease

interleukin-1 beta (IL-1 beta) synthesis capacity;GAD

Disease

rheumatoid arthritis;GAD

Disease

psoriasis;GAD

Disease

Leukemia;FunDO

Disease

Liver Neoplasms;GAD

Disease

METABOLIC;GAD

Disease

lupus erythematosus;GAD

Disease

Schizophrenia;FunDO

Disease

chronic bronchitis;GAD

Disease

cirrhosis, alcoholic;GAD

Disease

tuberculosis;GAD

Disease

diabetes, type 2;GAD

Disease

Tuberculosis;FunDO

Disease

Asthma;KEGG DISEASE;H00079

Disease

insulin resistance in obesity;GAD

Disease

parvovirus B19 infection;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

Lipodystrophy;GAD

Disease

Bladder cancer;FunDO

Disease

Melanoma;FunDO

Disease

myelopathy, HTLV-1 associated;GAD

Disease

Narcolepsy;FunDO

Disease

Plasmodium falciparum reinfections;GAD

Disease

INFECTION;GAD

Disease

REPRODUCTION;GAD

Disease

Hepatitis B;FunDO

Disease

Hypertension/complications*;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Celiac disease;FunDO

Disease

chronic active hepatitis C infection.;GAD

Disease

Obesity;FunDO

Disease

Anorexia nervosa;FunDO

Disease

increased development of adult T-cell leukemia/lymphoma;GAD

Disease

chemotherapy-induced pulmonary fibrosis;GAD

Disease

human narcolepsy.;GAD

Disease

kidney transplant complications;GAD

Disease

testicular cancer;GAD

Disease

stomach cancer;GAD

Disease

Asthma, susceptibility to;OMIM

Disease

Thrombophilia;FunDO

Disease

celiac;GAD

Disease

Lipodystrophy;FunDO

Disease

preterm delivery;GAD

Disease

Alzheimer's disease;GAD

Disease

kawasaki disease;GAD

Disease

Periodontitis;FunDO

Disease

ulcerative colitis and Crohn's disease;GAD

Disease

migraine;GAD

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Neonatal lupus;NHGRI

Disease

chronic obstructive pulmonary disease/COPD;GAD

Disease

Embryoma;FunDO

Disease

Crohn's disease ulcerative colitis;GAD

Disease

Fanconi's anemia;FunDO

Disease

Dementia;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

head and neck cancer;GAD

Disease

Aplastic anemia;FunDO

Disease

Asthma;GAD

Disease

periodontitis;GAD

Disease

Helicobacter pylori cagA subtype infection;GAD

Disease

Stroke;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Nephrosis;FunDO

Disease

Gastritis;GAD

Disease

Autoimmune disease;FunDO

Disease

alcohol abuse;GAD

Disease

Bone Mineral Density;GAD

Disease

primary sclerosing cholangitis;GAD

Disease

Diabetes mellitus;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

Lichen planus;FunDO

Disease

Crohn's disease inflammatory bowel disease ulcerative colitis;GAD

Disease

Malaria, cerebral, susceptibility to;OMIM

Disease

Celiac Disease;GAD

Disease

Chorioamnionitis;GAD

Disease

Asthma. Allergy.;GAD

Disease

Multiple sclerosis;FunDO

Disease

Familial Mediterranean fever;FunDO

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

thyroid-associated ophthalmopathy;GAD

Disease

Hypothyroidism;FunDO

Disease

Heart failure;FunDO

Disease

Primary Billiary Cirrosis;GAD

Disease

noncardia gastric cancer;GAD

Disease

GVHD;GAD

Disease

Ovary cancer;FunDO

Disease

limb deficiency anomalies;GAD

Disease

Malaria;FunDO

Disease

Lupus;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

7124

Links to all GeneRIF Items

7124

Links to iHOP

7124

Sequence Information

Nucleotide Sequence

>7124 : length: 702
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

Protein Sequence

>7124 : length: 233
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL



')