Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7076

Name

TIMP1

Synonym

CLGI|EPA|EPO|HCI|TIMP;TIMP metallopeptidase inhibitor 1;TIMP1;TIMP metallopeptidase inhibitor 1

Definition

TIMP-1|collagenase inhibitor|erythroid potentiating activity|erythroid-potentiating activity|fibroblast collagenase inhibitor|metalloproteinase inhibitor 1|tissue inhibitor of metalloproteinases 1

Position

Xp11.3-p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

inhibition of matrix metalloproteinases;PID BioCarta;100045

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Hemostasis;Reactome;REACT:604

Disease

CANCER;GAD

Disease

Lupus erythematosus;FunDO

Disease

Thyroid cancer;FunDO

Disease

Primary tumor;FunDO

Disease

Multiple myeloma;FunDO

Disease

Endometrial Neoplasms;GAD

Disease

Meningioma;FunDO

Disease

Lung cancer;FunDO

Disease

Biliary Atresia;FunDO

Disease

Melanoma;FunDO

Disease

Kidney disease;FunDO

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Muscular dystrophy;FunDO

Disease

Liver cancer;FunDO

Disease

Parkinson disease;FunDO

Disease

Aortic aneurysm;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Embryoma;FunDO

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

Dermatitis;FunDO

Disease

Prostate cancer;FunDO

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

Ulcerative colitis;FunDO

Disease

Subacute sclerosing panencephalitis;FunDO

Disease

Polycystic ovary syndrome;FunDO

Disease

Systemic infection;FunDO

Disease

Dental plaque;FunDO

Disease

Infiltrating cancer;FunDO

Disease

Colon cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Bronchopulmonary dysplasia;FunDO

Disease

Bronchiolitis obliterans;FunDO

Disease

Intracranial aneurysm;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Glomerulonephritis;FunDO

Disease

Crohn's disease ulcerative colitis;GAD

Disease

Liver metastases;FunDO

Disease

Endometriosis;FunDO

Disease

Leukemia;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Cervical cancer;FunDO

Disease

Hypertension;FunDO

Disease

Heart failure;FunDO

Disease

Hepatitis B;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Enteritis;FunDO

Disease

Lupus vulgaris;FunDO

Disease

Azoospermia;FunDO

Disease

Transient hypertension of pregnancy;FunDO

Disease

Skin cancer;FunDO

Disease

Ovary cancer;FunDO

Disease

Hodgkin's disease;FunDO

Disease

Asthma;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

7076

Links to all GeneRIF Items

7076

Links to iHOP

7076

Sequence Information

Nucleotide Sequence

>7076 : length: 624
atggccccctttgagcccctggcttctggcatcctgttgttgctgtggctgatagccccc
agcagggcctgcacctgtgtcccaccccacccacagacggccttctgcaattccgacctc
gtcatcagggccaagttcgtggggacaccagaagtcaaccagaccaccttataccagcgt
tatgagatcaagatgaccaagatgtataaagggttccaagccttaggggatgccgctgac
atccggttcgtctacacccccgccatggagagtgtctgcggatacttccacaggtcccac
aaccgcagcgaggagtttctcattgctggaaaactgcaggatggactcttgcacatcact
acctgcagttttgtggctccctggaacagcctgagcttagctcagcgccggggcttcacc
aagacctacactgttggctgtgaggaatgcacagtgtttccctgtttatccatcccctgc
aaactgcagagtggcactcattgcttgtggacggaccagctcctccaaggctctgaaaag
ggcttccagtcccgtcaccttgcctgcctgcctcgggagccagggctgtgcacctggcag
tccctgcggtcccagatagcctga

Protein Sequence

>7076 : length: 207
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRSQIA



')