Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7074

Name

TIAM1

Synonym

-;T-cell lymphoma invasion and metastasis 1;TIAM1;T-cell lymphoma invasion and metastasis 1

Definition

T-lymphoma invasion and metastasis-inducing protein 1|TIAM-1|human T-lymphoma invasion and metastasis inducing TIAM1 protein

Position

21q22.1|21q22.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Arf6 downstream pathway;PID Curated;200079

Disease

Connective tissue disease;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

7074

Links to all GeneRIF Items

7074

Links to iHOP

7074

Sequence Information

Nucleotide Sequence

>7074 : length: 4776
atgggaaacgcagaaagtcaacatgtagagcacgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacttcccgctccctgcgcctctcgcacaagacgcggaggaccagg
cacgcttcctcggggaaggtgatccacaggaactccgaagtgagcacccgatccagcagc
acccccagcatcccccagtccctggctgaaaatggcctggagcccttctcccaagatggt
accctagaagacttcgggagccccatctgggtggaccgagtggacatgggcttgagacct
gtgtcttacactgactcttctgtcactcccagcgtagacagcagcatcgtcctcacagca
gcctctgtgcagagcatgccagacactgaggagagcaggctttacggggatgacgctaca
tatttggctgagggaggcaggaggcagcattcctatacatccaatgggcccactttcatg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgccgaagagaaggactgcgaggaggctcgggggatggaaacgcgggcgagtccg
cggcagctcagcacctgtcagagagccaattccttgggtgacttgtatgctcagaaaaac
tctggagtgacagcaaacggggggccggggagcaaatttgcaggctactgtcggaatttg
gtgtctgatattcccaatcttgcaaaccataagatgccaccagctgctgctgaagagact
cctccgtacagtaattataacacacttccctgtaggaaatctcactgtctctctgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagctaaaacaact
caggatgttaatgcaggcgagggcagtgagtttgcagacagtgggattgaaggggccact
accgacacggacctcctgtccaggcgatctaatgccaccaactccagctactcacccacc
acaggccgggcctttgtgggcagcgacagcggcagcagctccaccggggatgcggctcgt
cagggggtgtacgagaacttccggcgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggccggctcggcgcacagcgatgagcagagcagcggcaccctgagctctccg
ggccagtcggacatcctgctgaccgccgcacagggcacggtgcgcaaggccggcgccctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcagccacccggagg
aagtggaagcactactgggtgtccctgaaaggatgcacgctatttttctacgagagcgac
ggcaggtctgggatagaccacaacagcatccccaaacacgccgtctgggtggagaacagc
attgtgcaggcggtgcctgagcaccccaagaaggactttgtcttctgcctcagcaattcc
ctgggtgatgccttcctttttcagaccactagccagacggagcttgaaaactggatcacc
gccatccactctgcctgcgccactgcggtcgcgaggcaccaccacaaggaagacacgctc
cgactcctgaaatcagagatcaaaaaactggaacagaagattgacatggatgaaaagatg
aagaaaatgggtgaaatgcagctgtcttcagtcactgactcaaagaaaaagaaaacaata
ttagatcagatctttgtctgggagcaaaatctcgagcagttccaaatggacctgtttcgt
ttccgctgttatttagccagccttcagggtggggagctgccaaaccccaaaaggcttctc
gcttttgcaagtcgaccaacgaaagtggccatgggccgccttggaatcttttcggtatca
tcgtttcatgccctggtggcagcacgcactggtgaaactggagtgagaagacgtactcag
gccatgtccagatccgcgagcaagcgaaggagcaggttttcttctctgtggggtctggat
actacctccaaaaagaagcagggacggccaagcatcaatcaggtgtttggagagggaacc
gaagctgtaaagaaatctttagagggaatatttgatgacattgttccagatggcaagagg
gagaaagaagtggtcttacctaacgttcaccagcacaaccctgactgcgacatttgggtc
cacgagtatttcactccatcctggttctgtctgcccaataatcagcctgccctgacggtc
gtccggccaggcgacactgcacgggacaccctggagctgatttgcaagacacatcaactg
gatcattctgctcattacctgcgcctgaaatttctaatagaaaacaaaatgcagctctat
gttccacagcccgaggaagacatctatgagctgctgtacaaagaaattgaaatctgtcca
aaagtcactcagagcatccacattgagaagtcagatacagctgctgatacttacgggttt
tcactttcttctgtggaagaagatggtattcgaaggctgtacgtgaatagtgtgaaggaa
accggtttagcttccaagaaaggcctgaaagcaggagatgagattcttgagatcaataat
cgtgctgctgacgccctgaactcttctatgctcaaagatttcctctcacagccctcgctg
ggcctcctggtgaggacctaccccgagctggaggaaggagtggagctgctggaaagcccg
ccccaccgagtggacggccctgccgaccttggcgagagccccctcgcctttctcaccagc
aacccagggcacagcctttgcagcgagcagggcagcagtgctgagaccgctccagaggag
accgaggggccagacttggaatcctcagatgagactgatcacagcagcaagagtacagaa
caggtggccgcattttgccgcagtttgcatgagatgaacccctctgaccagagcccatct
cctcaggactccacggggcctcagctggcgaccatgagacaactctcggatgcagataag
ctgcgcaaggtgatctgcgagctcctggagacggagcgcacctacgtgaaggatttaaac
tgtcttatggagagatacctaaagcctcttcaaaaagaaacttttctcacccaggatgag
cttgacgtgctttttggaaatttaacggaaatggtagagtttcaagtagaattccttaaa
actctagaagatggagtgagactggtacctgatttggaaaagcttgagaaggttgatcaa
tttaagaaagtgctgttctctctggggggatcattcctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacaaaagttcccaaggtcctggtgaaagccaag
acagacacggctttcaaggcattcttggatgcccagaacccgaagcagcagcactcatcc
acgctggagtcgtacctcatcaagcccatccagaggatcctcaagtacccacttctgctc
agggagctgttcgccctgaccgatgcggagagcgaggagcactaccacctggacgtggcc
atcaagaccatgaacaaggttgccagtcacatcaatgagatgcagaaaatccatgaagag
tttggggctgtgtttgaccagctgattgctgaacagactggtgagaaaaaagaggttgca
gatctgagcatgggagacctgcttttgcacactaccgtgatctggctgaacccgccggcc
tcgctgggcaagtggaaaaaggaaccagagttggcagcattcgtcttcaaaactgctgtg
gtccttgtgtataaagatggttccaaacagaagaagaaacttgtaggatctcacaggctt
tccatttatgaggactgggaccccttcagatttcgacacatgatccccacggaagcgctg
caggttcgagctttggcgagtgcagatgcagaggcaaatgccgtgtgtgaaattgtccat
gtaaaatccgagtctgaagggaggccggagagggtctttcacttgtgctgcagctcccca
gagagccgaaaggatttcctaaaggctgtgcattcaatcctgcgtgataagcacagaaga
cagctcctcaaaaccgagagccttccctcatcccagcaatatgtcccttttggaggcaaa
agattgtgtgcactgaagggggccaggccggccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggaggcggcggctggctcgaaacaggtttaccattgattctgat
gccgtctccgcaagcagcccggagaaagagtcccagcagccccccggtggtggggacact
gaccgatgggtagaggagcagtttgatcttgctcagtatgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtccgtgaagggtgcctcagtg
gacagagacctgcaggagcggcttcaggccacctccatcagtcagcgggaaagaggccgg
aaaaccctggatagtcacgcgtcccgcatggcacagctcaagaagcaagctgccctgtcg
gggatcaatggaggcctggagagcgcaagcgaggaagtcatttgggttaggcgtgaagac
tttgccccctccaggaaactgaacactgagatctga

Protein Sequence

>7074 : length: 1591
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDTEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI



')