Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7056

Name

THBD

Synonym

AHUS6|BDCA3|CD141|THRM|TM;thrombomodulin;THBD;thrombomodulin

Definition

CD141 antigen|fetomodulin

Position

20p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Complement and coagulation cascades;KEGG PATHWAY;hsa04610

Pathway

Common Pathway;PID Reactome;500303

Pathway

Blood coagulation;PANTHER;P00011

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Hemostasis;Reactome;REACT:604

Disease

Hematologic diseases;KEGG DISEASE

Disease

Circulatory system diseases;KEGG DISEASE

Disease

Thrombophilia due to thrombomodulin defect;OMIM

Disease

atherosclerosis, coronary;GAD

Disease

cerebral infarct;GAD

Disease

thrombosis, deep vein;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Stroke;GAD

Disease

acute myocardial infarction;GAD

Disease

Myocardial Infarction;GAD

Disease

Hemolytic uremic syndrome, atypical, susceptibility to, 6;OMIM

Disease

Atherosclerosis;GAD

Disease

Myocardial infarction, susceptibility to;OMIM

Disease

Inherited thrombophilia;KEGG DISEASE;H00223

External Links

Links to Entrez Gene

7056

Links to all GeneRIF Items

7056

Links to iHOP

7056

Sequence Information

Nucleotide Sequence

>7056 : length: 1728
atgcttggggtcctggtccttggcgcgctggccctggccggcctggggttccccgcaccc
gcagagccgcagccgggtggcagccagtgcgtcgagcacgactgcttcgcgctctacccg
ggccccgcgaccttcctcaatgccagtcagatctgcgacggactgcggggccacctaatg
acagtgcgctcctcggtggctgccgatgtcatttccttgctactgaacggcgacggcggc
gttggccgccggcgcctctggatcggcctgcagctgccacccggctgcggcgaccccaag
cgcctcgggcccctgcgcggcttccagtgggttacgggagacaacaacaccagctatagc
aggtgggcacggctcgacctcaatggggctcccctctgcggcccgttgtgcgtcgctgtc
tccgctgctgaggccactgtgcccagcgagccgatctgggaggagcagcagtgcgaagtg
aaggccgatggcttcctctgcgagttccacttcccagccacctgcaggccactggctgtg
gagcccggcgccgcggctgccgccgtctcgatcacctacggcaccccgttcgcggcccgc
ggagcggacttccaggcgctgccggtgggcagctccgccgcggtggctcccctcggctta
cagctaatgtgcaccgcgccgcccggagcggtccaggggcactgggccagggaggcgccg
ggcgcttgggactgcagcgtggagaacggcggctgcgagcacgcgtgcaatgcgatccct
ggggctccccgctgccagtgcccagccggcgccgccctgcaggcagacgggcgctcctgc
accgcatccgcgacgcagtcctgcaacgacctctgcgagcacttctgcgttcccaacccc
gaccagccgggctcctactcgtgcatgtgcgagaccggctaccggctggcggccgaccaa
caccggtgcgaggacgtggatgactgcatactggagcccagtccgtgtccgcagcgctgt
gtcaacacacagggtggcttcgagtgccactgctaccctaactacgacctggtggacggc
gagtgtgtggagcccgtggacccgtgcttcagagccaactgcgagtaccagtgccagccc
ctgaaccaaactagctacctctgcgtctgcgccgagggcttcgcgcccattccccacgag
ccgcacaggtgccagatgttttgcaaccagactgcctgtccagccgactgcgaccccaac
acccaggctagctgtgagtgccctgaaggctacatcctggacgacggtttcatctgcacg
gacatcgacgagtgcgaaaacggcggcttctgctccggggtgtgccacaacctccccggt
accttcgagtgcatctgcgggcccgactcggcccttgcccgccacattggcaccgactgt
gactccggcaaggtggacggtggcgacagcggctctggcgagcccccgcccagcccgacg
cccggctccaccttgactcctccggccgtggggctcgtgcattcgggcttgctcataggc
atctccatcgcgagcctgtgcctggtggtggcgcttttggcgctcctctgccacctgcgc
aagaagcagggcgccgccagggccaagatggagtacaagtgcgcggccccttccaaggag
gtagtgctgcagcacgtgcggaccgagcggacgccgcagagactctga

Protein Sequence

>7056 : length: 575
MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM
TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS
RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAV
EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP
GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP
DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG
ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC
DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR
KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL



')