Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7049

Name

TGFBR3

Synonym

BGCAN|betaglycan;transforming growth factor, beta receptor III;TGFBR3;transforming growth factor, beta receptor III

Definition

TGF-beta receptor type 3|TGF-beta receptor type III|TGFR-3|betaglycan proteoglycan|transforming growth factor beta receptor type 3

Position

1p33-p32

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Disease

Bone Mineral Density;GAD

Disease

REPRODUCTION;GAD

Disease

premature ovarian failure primary amenorrhea;GAD

Disease

Bacteremia;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Pulmonary Emphysema;GAD

Disease

Pulmonary Disease, Chronic Obstructive;GAD

Disease

METABOLIC;GAD

Disease

INFECTION;GAD

Disease

Bone mineral density;NHGRI

External Links

Links to Entrez Gene

7049

Links to all GeneRIF Items

7049

Links to iHOP

7049

Sequence Information

Nucleotide Sequence

>7049 : length: 2553
atgacttcccattatgtgattgccatctttgccctgatgagctcctgtttagccactgca
ggtccagagcctggtgcactgtgtgaactgtcacctgtcagtgcctcccatcctgtccag
gccttgatggagagcttcactgttttgtcaggctgtgccagcagaggcacaactgggctg
ccacaggaggtgcatgtcctgaatctccgcactgcaggccaggggcctggccagctacag
agagaggtcacacttcacctgaatcccatctcctcagtccacatccaccacaagtctgtt
gtgttcctgctcaactccccacaccccctggtgtggcatctgaagacagagagacttgcc
actggggtctccagactgtttttggtgtctgagggttctgtggtccagttttcatcagca
aacttctccttgacagcagaaacagaagaaaggaacttcccccatggaaatgaacatctg
ttaaattgggcccgaaaagagtatggagcagttacttcattcaccgaactcaagatagca
agaaacatttatattaaagtgggggaagatcaagtgttccctccaaagtgcaacataggg
aagaattttctctcactcaattaccttgctgagtaccttcaacccaaagcagcagaaggg
tgtgtgatgtccagccagccccagaatgaggaagtacacatcatcgagctaatcaccccc
aactctaacccctacagtgctttccaggtggatataacaattgatataagaccttctcaa
gaggatcttgaagtggtcaaaaatctcatcctgatcttgaagtgcaaaaagtctgtcaac
tgggtgatcaaatcttttgatgttaagggaagcctgaaaattattgctcctaacagtatt
ggctttggaaaagagagtgaaagatctatgacaatgaccaaatcaataagagatgacatt
ccttcaacccaagggaatctggtgaagtgggctttggacaatggctatagtccaataact
tcatacacaatggctcctgtggctaatagatttcatcttcggcttgaaaataatgaggag
atgggagatgaggaagtccacactattcctcctgagctacggatcctgctggaccctggt
gccctgcctgccctgcagaacccgcccatccggggaggggaaggccaaaatggaggcctt
ccgtttcctttcccagatatttccaggagagtctggaatgaagagggagaagatgggctc
cctcggccaaaggaccctgtcattcccagcatacaactgtttcctggtctcagagagcca
gaagaggtgcaagggagcgtggatattgccctgtctgtcaaatgtgacaatgagaagatg
atcgtggctgtagaaaaagattcttttcaggccagtggctactcggggatggacgtcacc
ctgttggatcctacctgcaaggccaagatgaatggcacacactttgttttggagtctcct
ctgaatggctgcggtactcggccccggtggtcagcccttgatggtgtggtctactataac
tccattgtgatacaggttccagcccttggggacagtagtggttggccagatggttatgaa
gatctggagtcaggtgataatggatttccgggagatatggatgaaggagatgcttccctg
ttcacccgacctgaaatcgtggtgtttaattgcagccttcagcaggtgaggaaccccagc
agcttccaggaacagccccacggaaacatcaccttcaacatggagctatacaacactgac
ctctttttggtgccctcccagggcgtcttctctgtgccagagaatggacacgtttatgtt
gaggtatctgttactaaggctgaacaagaactgggatttgccatccaaacgtgctttatc
tctccatattcgaaccctgataggatgtctcattacaccattattgagaatatttgtcct
aaagatgaatctgtgaaattctacagtcccaagagagtgcactttcctatcccgcaagct
gacatggataagaagcgattcagctttgtcttcaagcctgtcttcaacacctcactgctc
tttctacagtgtgagctgacgctgtgtacgaagatggagaagcacccccagaagttgcct
aagtgtgtgcctcctgacgaagcctgcacctcgctggacgcctcgataatctgggccatg
atgcagaataagaagacgttcactaagccccttgctgtgatccaccatgaagcagaatct
aaagaaaaaggtccaagcatgaaggaaccaaatccaatttctccaccaattttccatggt
ctggacaccctaaccgtgatgggcattgcgtttgcagcctttgtgatcggagcactcctg
acgggggccttgtggtacatctattctcacacaggggagacagcaggaaggcagcaagtc
cccacctccccgccagcctcggaaaacagcagtgctgcccacagcatcggcagcacgcag
agcacgccttgctccagcagcagcacggcctag

Protein Sequence

>7049 : length: 850
MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGL
PQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLA
TGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIA
RNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITP
NSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSI
GFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEE
MGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGL
PRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVT
LLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYE
DLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTD
LFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICP
KDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLP
KCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHG
LDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQ
STPCSSSSTA



')