Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7046

Name

TGFBR1

Synonym

AAT5|ACVRLK4|ALK-5|ALK5|LDS1A|LDS2A|MSSE|SKR4|TGFR-1;transforming growth factor, beta receptor 1;TGFBR1;transforming growth factor, beta receptor 1

Definition

TGF-beta receptor type I|TGF-beta receptor type-1|TGF-beta type I receptor|activin A receptor type II-like kinase, 53kD|activin A receptor type II-like kinase, 53kDa|activin A receptor type II-like protein kinase of 53kD|activin receptor-like kinase 5|ser

Position

9q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

Signaling by TGF beta;PID Reactome;500590

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Disease

Loeys-Dietz syndrome, type 1A;OMIM

Disease

cancer;GAD

Disease

kidney cancer;GAD

Disease

prostate cancer;GAD

Disease

CANCER;GAD

Disease

bladder cancer;GAD

Disease

INFECTION;GAD

Disease

Loeys-Dietz syndrome, type 2A;OMIM

Disease

respiratory syncytial virus bronchiolitis;GAD

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

7046

Links to all GeneRIF Items

7046

Links to iHOP

7046

Sequence Information

Nucleotide Sequence

>7046 : length: 1281
atggaggcggcggtcgctgctccgcgtccccggctgctcctcctcgtgctggcggcggcg
gcggcggcggcggcggcgctgctcccgggggcgacggcgttacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagag
accacagacaaagttatacacaacagcatgtgtatagctgaaattgacttaattcctcga
gataggccgtttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactggtttaccattgcttgtt
cagagaacaattgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttgga
gaagtttggagaggaaagtggcggggagaagaagttgctgttaagatattctcctctaga
gaagaacgttcgtggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaa
aacatcctgggatttatagcagcagacaataaagacaatggtacttggactcagctctgg
ttggtgtcagattatcatgagcatggatccctttttgattacttaaacagatacacagtt
actgtggaaggaatgataaaacttgctctgtccacggcgagcggtcttgcccatcttcac
atggagattgttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaag
aatatcttggtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaaga
catgattcagccacagataccattgatattgctccaaaccacagagtgggaacaaaaagg
tacatggcccctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaa
cgtgctgacatctatgcaatgggcttagtattctgggaaattgctcgacgatgttccatt
ggtggaattcatgaagattaccaactgccttattatgatcttgtaccttctgacccatca
gttgaagaaatgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacaga
tggcagagctgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgcc
aatggagcagctaggcttacagcattgcggattaagaaaacattatcgcaactcagtcaa
caggaaggcatcaaaatgtaa

Protein Sequence

>7046 : length: 426
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLV
QRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHE
NILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLH
MEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKR
YMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPS
VEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQ
QEGIKM



')