Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7042

Name

TGFB2

Synonym

TGF-beta2;transforming growth factor, beta 2;TGFB2;transforming growth factor, beta 2

Definition

BSC-1 cell growth inhibitor|G-TSF|TGF-beta-2|cetermin|glioblastoma-derived T-cell suppressor factor|polyergin|transforming growth factor beta-2

Position

1q41

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

Immune system diseases;KEGG DISEASE

Disease

Graft-versus-host disease;KEGG DISEASE;H00084

Disease

Allergies and autoimmune diseases;KEGG DISEASE

External Links

Links to Entrez Gene

7042

Links to all GeneRIF Items

7042

Links to iHOP

7042

Sequence Information

Nucleotide Sequence

>7042 : length: 1329
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgttcgattt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtgcctgaacaacggattgagctatatcagattctc
aagtccaaagatttaacatctccaacccagcgctacatcgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacttttgta
ccatctaataattacatcatcccaaataaaagtgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcggcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggcaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

Protein Sequence

>7042 : length: 442
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS



')