Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7041

Name

TGFB1I1

Synonym

ARA55|HIC-5|HIC5|TSC-5;transforming growth factor beta 1 induced transcript 1;TGFB1I1;transforming growth factor beta 1 induced transcript 1

Definition

androgen receptor coactivator 55 kDa protein|androgen receptor coactivator ARA55|androgen receptor-associated protein of 55 kDa|hydrogen peroxide-inducible clone 5 protein|transforming growth factor beta-1-induced transcript 1 protein

Position

16p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Angiogenesis;PANTHER;P00005

External Links

Links to Entrez Gene

7041

Links to all GeneRIF Items

7041

Links to iHOP

7041

Sequence Information

Nucleotide Sequence

>7041 : length: 1386
atggaggacctggatgccctgctctctgacctggagactaccacctcgcacatgccaagg
tcaggggctcccaaagagcgccctgcggagcctctcacccctcccccatcctatggccac
cagccacagacagggtctggggagtcttcaggagcctcgggggacaaggaccacctgtac
agcacggtatgcaagcctcggtccccaaagcctgcagccccggcggcccctccattctcc
tcttccagcggtgtcttgggtaccgggctctgtgagctagatcggttgcttcaggaactt
aatgccactcagttcaacatcacagatgaaatcatgtctcagttcccatctagcaaggtg
gcttcaggagagcagaaggaggaccagtctgaagataagaaaagacccagcctcccttcc
agcccgtctcctggcctcccaaaggcttctgccacctcagccactctggagctggataga
ctgatggcctcactctctgacttccgcgttcaaaaccatcttccagcctctgggccaact
cagccaccggtggtgagctccacaaatgagggctccccatccccaccagagccgactggc
aagggcagcctagacaccatgctggggctgctgcagtccgacctcagccgccggggtgtt
cccacccaggccaaaggcctctgtggctcctgcaataaacctattgctgggcaagtggtg
acggctctgggccgcgcctggcaccccgagcacttcgtttgcggaggctgttccaccgcc
ctgggaggcagcagcttcttcgagaaggatggagcccccttctgccccgagtgctacttt
gagcgcttctcgccaagatgtggcttctgcaaccagcccatccgacacaagatggtgacc
gccttgggcactcactggcacccagagcatttctgctgcgtcagttgcggggagcccttc
ggagatgagggtttccacgagcgcgagggccgcccctactgccgccgggacttcctgcag
ctgttcgccccgcgctgccagggctgccagggccccatcctggataactacatctcggcg
ctcagcgcgctctggcacccggactgtttcgtctgcagggaatgcttcgcgcccttctcg
ggaggcagctttttcgagcacgagggccgcccgttgtgcgagaaccacttccacgcacga
cgcggctcgctgtgcgccacgtgtggcctccctgtgaccggccgctgcgtgtcggccctg
ggtcgccgcttccacccggaccacttcacatgcaccttctgcctgcgcccgctcaccaag
gggtccttccaggagcgcgccggcaagccctactgccagccctgcttcctgaagctcttc
ggctga

Protein Sequence

>7041 : length: 461
MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPT
QPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG



')