Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7040

Name

TGFB1

Synonym

CED|DPD1|LAP|TGFB|TGFbeta;transforming growth factor, beta 1;TGFB1;transforming growth factor, beta 1

Definition

TGF-beta 1 protein|TGF-beta-1|latency-associated peptide|transforming growth factor beta-1

Position

19q13.2|19q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

Influenza Virus Induced Apoptosis;PID Reactome;500929

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Signaling by TGF beta;PID Reactome;500590

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Influenza Infection;Reactome;REACT:6167

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Glomerulonephritis, IGA;GAD

Disease

allergic rhinitis;GAD

Disease

vesicoureteral reflux;GAD

Disease

Sjogren's syndrome;GAD

Disease

HEMATOLOGICAL;GAD

Disease

radiotherapy response;GAD

Disease

ossification of the posterior longitudinal ligament;GAD

Disease

proliferative vitreoretinopathy rhegmatogenous retinal detachment;GAD

Disease

parvovirus B19 infection;GAD

Disease

cardiovascular;GAD

Disease

breast cancer;GAD

Disease

hepatitis B;GAD

Disease

rheumatic heart disease;GAD

Disease

nephropathy;GAD

Disease

radiotherapy;GAD

Disease

prostatic hyperplasia;GAD

Disease

hepatitis C;GAD

Disease

testicular cancer;GAD

Disease

lung cancer;GAD

Disease

early onset ischemic heart disease.;GAD

Disease

IMMUNE;GAD

Disease

preterm delivery;GAD

Disease

Giardiasis;GAD

Disease

duodenal ulcer gastric ulcer;GAD

Disease

prostate cancer;GAD

Disease

pancreatitis, chronic;GAD

Disease

Asthma;GAD

Disease

blood pressure;GAD

Disease

periodontitis;GAD

Disease

prevalent vertebral fractures;GAD

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

Cystic fibrosis lung disease, modifier of;OMIM

Disease

INFECTION;GAD

Disease

Constriction, Pathologic;GAD

Disease

Bone Mineral Density;GAD

Disease

METABOLIC;GAD

Disease

bone density;GAD

Disease

radiation-induced damage to normal tissues;GAD

Disease

heart transplant complications;GAD

Disease

REPRODUCTION;GAD

Disease

CARDIOVASCULAR;GAD

Disease

cystic fibrosis;GAD

Disease

CANCER;GAD

Disease

Myocardial Infarction;GAD

Disease

HIV Infections;GAD

Disease

NEUROLOGICAL;GAD

Disease

VISION;GAD

Disease

Asthma severity;GAD

Disease

very low bone mass;GAD

Disease

atopic dermatitis;GAD

Disease

Graft-versus-host disease;KEGG DISEASE;H00084

Disease

allograft outcome;GAD

Disease

leukemia;GAD

Disease

idiopathic pulmonary fibrosis;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Osteoporosis;GAD

Disease

Camurati-Engelmann disease;OMIM

Disease

Allergies and autoimmune diseases;KEGG DISEASE

Disease

increased incidence of invasive breast cancer;GAD

Disease

Migraine Disorders;GAD

Disease

Graft vs Host Disease;GAD

Disease

Pneumoconiosis;GAD

Disease

stomach cancer;GAD

Disease

chronic idiopathic neutropenia;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

7040

Links to all GeneRIF Items

7040

Links to iHOP

7040

Sequence Information

Nucleotide Sequence

>7040 : length: 1173
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

Protein Sequence

>7040 : length: 390
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS



')