Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7039

Name

TGFA

Synonym

TFGA;transforming growth factor, alpha;TGFA;transforming growth factor, alpha

Definition

TGF-alpha|protransforming growth factor alpha

Position

2p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

ErbB receptor signaling network;PID Curated;200136

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Disease

cleft lip with cleft palate cleft lip without cleft palate cleft palate;GAD

Disease

Cancers;KEGG DISEASE

Disease

Cleft Palate;GAD

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cleft Lip;GAD

Disease

DEVELOPMENTAL;GAD

Disease

CANCER;GAD

Disease

cutaneous malignant melanoma.;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

cleft lip with cleft palate;GAD

Disease

cleft lip without cleft palate;GAD

Disease

non-syndromic cleft lip and palate;GAD

Disease

cleft lip and palate;GAD

External Links

Links to Entrez Gene

7039

Links to all GeneRIF Items

7039

Links to iHOP

7039

Sequence Information

Nucleotide Sequence

>7039 : length: 480
atggtcccctcggctggacagctcgccctgttcgctctgggtattgtgttggctgcgtgc
caggccttggagaacagcacgtccccgctgagtgacccgcccgtggctgcagcagtggtg
tcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgcacgc
tgtgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggccatcacc
gccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctgata
cactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtctga

Protein Sequence

>7039 : length: 159
MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV



')