Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7024

Name

TFCP2

Synonym

LBP1C|LSF|LSF1D|SEF|TFCP2C;transcription factor CP2;TFCP2;transcription factor CP2

Definition

SAA3 enhancer factor|alpha-globin transcription factor CP2

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Disease

Alzheimer's disease;GAD

Disease

Alzheimer's disease depressive disorder, major;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

7024

Links to all GeneRIF Items

7024

Links to iHOP

7024

Sequence Information

Nucleotide Sequence

>7024 : length: 1506
atggcctgggctctgaagctgcctctggccgacgaagtgattgaatccgggttggtgcag
gactttgatgctagcctgtccgggatcggccaggaactgggtgctggtgcctatagcatg
agtgatgtccttgcattgcccatttttaagcaagaagagtcgagtttgcctcctgataat
gagaataaaatcctgccttttcaatatgtgctttgtgctgctacctctccagcagtgaaa
ctccatgatgaaaccctaacgtatctcaatcaaggacagtcttatgaaattcgaatgcta
gacaataggaaacttggagaacttccagaaattaatggcaaattggtgaagagtatattc
cgtgtggtgttccatgacagaaggcttcagtacactgagcatcagcagctagagggctgg
aggtggaaccgacctggagacagaattcttgacatagatatcccgatgtctgtgggtata
atcgatcctagggctaatccaactcaactaaatacagtggagttcctgtgggaccctgca
aagaggacatctgtgtttattcaggtgcactgtattagcacagagttcactatgaggaaa
catggtggagaaaagggggtgccattccgagtacaaatagataccttcaaggagaatgaa
aacggggaatatactgagcacttacactcggccagctgccagatcaaagttttcaagccc
aaaggtgcagacagaaagcaaaaaacggatagggaaaaaatggagaaacgaacacctcat
gaaaaggagaaatatcagccttcctatgagacaaccatactcacagagtgttctccatgg
cccgagatcacgtatgtcaataactccccatcacctggcttcaacagttcccatagcagt
ttttctcttggggaaggaaatggttcaccaaaccaccagccagagccaccccctccagtc
acagataacctcttaccaacaaccacacctcaggaagctcagcagtggttgcatcgaaat
cgtttttctacattcacaaggcttttcacaaacttctcaggggcagatttattgaaatta
actagagatgatgtgatccaaatctgtggccctgcagatggaatcagactttttaatgca
ttaaaaggccggatggtgcgtccaaggttaaccatttatgtttgtcaggaatcactgcag
ttgagggagcagcaacaacagcagcagcaacagcagcagaagcatgaggatggagactca
aatggtactttcttcgtttaccatgctatctatctagaagaactaacagctgttgaattg
acagaaaaaattgctcagcttttcagcatttccccttgccagatcagccagatttacaag
caggggccaacaggaattcatgtgctcatcagtgatgagatgatacagaactttcaggaa
gaagcatgttttattctggacacaatgaaagaaaccaatgatagctatcatatcatactg
aagtag

Protein Sequence

>7024 : length: 501
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
ENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIF
RVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPA
KRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKP
KGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQE
EACFILDTMKETNDSYHIILK



')