Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7003

Name

TEAD1

Synonym

AA|NTEF-1|REF1|TCF-13|TCF13|TEAD-1|TEF-1;TEA domain family member 1 (SV40 transcriptional enhancer factor);TEAD1;TEA domain family member 1 (SV40 transcriptional enhancer factor)

Definition

protein GT-IIC|transcription factor 13|transcriptional enhancer factor 1|transcriptional enhancer factor TEF-1

Position

11p15.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

7003

Links to all GeneRIF Items

7003

Links to iHOP

7003

Sequence Information

Nucleotide Sequence

>7003 : length: 1281
attgagcccagcagctggagcggcagtgagagccctgccgaaaacatggaaaggatgagt
gactctgcagataagccaattgacaatgatgcagaaggggtctggagccccgacatcgag
caaagctttcaggaggccctggctatctatccaccatgtgggaggaggaaaatcatctta
tcagacgaaggcaaaatgtatggtaggaatgaattgatagccagatacatcaaactcagg
acaggcaagacgaggaccagaaaacaggtgtctagtcacattcaggttcttgccagaagg
aaatctcgtgattttcattccaagctaaaggatcagactgcaaaggataaggccctgcag
cacatggcggccatgtcctcagcccagatcgtctcggccactgccattcataacaagctg
gggctgcctgggattccacgcccgaccttcccaggggcgccggggttctggccgggaatg
attcaaacagggcagccaggatcctcacaagacgtcaagccttttgtgcagcaggcctac
cccatccagccagcggtcacagcccccattccagggtttgagcctgcatcggccccagct
ccctcagtccctgcctggcaaggtcgctccattggcacaaccaagcttcgcctggtggaa
ttttcagcttttctcgagcagcagcgagacccagactcgtacaacaaacacctcttcgtg
cacattgggcatgccaaccattcttacagtgacccattgcttgaatcagtggacattcgt
cagatttatgacaaatttcctgaaaagaaaggtggcttaaaggaactgtttggaaagggc
cctcaaaatgccttcttcctcgtaaaattctgggctgatttaaactgcaatattcaagat
gatgctggggctttttatggtgtaaccagtcagtacgagagttctgaaaatatgacagtc
acctgttccaccaaagtttgctcctttgggaagcaagtagtagaaaaagtagagacggag
tatgcaaggtttgagaatggccgatttgtataccgaataaaccgctccccaatgtgtgaa
tatatgatcaacttcatccacaagctcaaacacttaccagagaaatatatgatgaacagt
gttttggaaaacttcacaattttattggtggtaacaaacagggatacacaagaaactcta
ctctgcatggcctgtgtgtttgaagtttcaaatagtgaacacggagcacaacatcatatt
tacaggcttgtaaaggactga

Protein Sequence

>7003 : length: 426
MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQ
HMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAY
PIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFV
HIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCE
YMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI
YRLVKD



')