Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6997

Name

TDGF1

Synonym

CR|CRGF|CRIPTO;teratocarcinoma-derived growth factor 1;TDGF1;teratocarcinoma-derived growth factor 1

Definition

cripto-1 growth factor|epidermal growth factor-like cripto protein CR1

Position

3p21.31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glypican 1 network;PID Curated;200021

Disease

Forebrain defects;OMIM

External Links

Links to Entrez Gene

6997

Links to all GeneRIF Items

6997

Links to iHOP

6997

Sequence Information

Nucleotide Sequence

>6997 : length: 519
atggccatttctaaagtctttgaactgggattagttgccgggctgggccatcaggaattt
gctcgtccatctcggggatacctggccttcagagatgacagcatttggccccaggaggag
cctgcaattcggcctcggtcttcccagcgtgtgccgcccatggggatacagcacagtaag
gagctaaacagaacctgctgcctgaatgggggaacctgcatgctggggtccttttgtgcc
tgccctccctccttctacggacggaactgtgagcacgatgtgcgcaaagagaactgtggg
tctgtgccccatgacacctggctgcccaagaagtgttccctgtgtaaatgctggcacggt
cagctccgctgctttcctcaggcatttctacccggctgtgatggccttgtgatggatgag
cacctcgtggcttccaggactccagaactaccaccgtctgcacgtactaccacttttatg
ctagttggcatctgcctttctatacaaagctactattaa

Protein Sequence

>6997 : length: 172
MAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK
ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHG
QLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY



')