Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6943

Name

TCF21

Synonym

POD1|bHLHa23;transcription factor 21;TCF21;transcription factor 21

Definition

TCF-21|capsulin|class A basic helix-loop-helix protein 23|epicardin|pod-1|podocyte-expressed 1

Position

6q23-q24

Gene Type

protein-coding

External Links

Links to Entrez Gene

6943

Links to all GeneRIF Items

6943

Links to iHOP

6943

Sequence Information

Nucleotide Sequence

>6943 : length: 540
atgtccaccggctccctcagcgatgtggaggaccttcaagaggtggagatgttggaatgt
gacgggttgaaaatggattcgaacaaggaatttgtgacttccaacgagagcaccgaggag
agctccaactgcgagaatgggtctccccagaagggccgcggcggcctgggcaagaggagg
aaggcgcccaccaagaagagccccctgagcggggtcagccaggaggggaagcaggtccag
cgcaacgccgccaacgcgcgagagcgggcccgcatgcgagtgctgagcaaggccttctcc
agactcaagaccaccctgccctgggtgccccccgacaccaagctctccaagctggacacg
ctcaggctggcgtccagctacatcgcccacttgaggcagatcctggctaacgacaaatac
gagaacgggtacattcacccggtcaacctgacgtggccctttatggtggccgggaaaccc
gagagtgacctgaaagaagtggtgaccgcgagccgcttatgtggaaccaccgcgtcctga

Protein Sequence

>6943 : length: 179
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS



')