Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6935

Name

ZEB1

Synonym

AREB6|BZP|DELTAEF1|FECD6|NIL2A|PPCD3|TCF8|ZFHEP|ZFHX1A;zinc finger E-box binding homeobox 1;ZEB1;zinc finger E-box binding homeobox 1

Definition

delta-crystallin enhancer binding factor 1|negative regulator of IL2|posterior polymorphous corneal dystrophy 3|transcription factor 8 (represses interleukin 2 expression)|zinc finger E-box-binding homeobox 1|zinc finger homeodomain enhancer-binding prote

Position

10p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

sumoylation as a mechanism to modulate ctbp-dependent gene responses;PID BioCarta;100195

Disease

Corneal dystrophy, Fuchs endothelial, 6;OMIM

Disease

Waist-hip ratio;NHGRI

Disease

Corneal dystrophy, posterior polymorphous, 3;OMIM

External Links

Links to Entrez Gene

6935

Links to all GeneRIF Items

6935

Links to iHOP

6935

Sequence Information

Nucleotide Sequence

>6935 : length: 3327
atgaaagttacaaattataatactgtggtagaaacaaattcagattcagatgatgaagac
aaactgcatattgtggaagaagaaagtgttacagatgcagctgactgtgaaggtgtacca
gaggatgacctgccaacagaccagacagtgttaccagggaggagcagtgaaagagaaggg
aatgctaagaactgctgggaggatgacacaggaaaggaagggcaagaaatcctggggcct
gaagctcaggcagatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgca
gaaaatgagcaaaaccatgatcctaatgttgaagagtttctacaacaacaagacactgct
gtcatttttcctgaggcacctgaagaggaccagaggcagggcacaccagaagccagtggt
catgatgaaaatggaacaccagatgcattttcacaattactcacctgtccatattgtgat
agaggctataaacgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaat
gaagataactttagttgctccctgtgcagttacacctttgcatacagaacccaacttgaa
cgtcacatgacatcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgt
aatcgtaaattcaaatgcactgagtgtggaaaagctttcaaatacaaacatcacctaaaa
gagcacttaagaattcacagtggagagaagccatatgaatgcccaaactgcaagaaacgc
ttttcccattctggctcctatagctcacacataagcagtaagaaatgtatcagcttgata
cctgtgaatgggcgaccaagaacaggactcaagacatctcagtgttcttcaccgtctctt
tcagcatcaccaggcagtcccacacgaccacagatacggcaaaagatagagaataaaccc
cttcaagaacaactttctgttaaccaaattaaaactgaacctgtggattatgaattcaaa
cccatagtggttgcttcaggaatcaactgttcaacccctttacaaaatggggttttcact
ggtggtggcccattacaggcaaccagttctcctcagggcatggtgcaagctgttgttctg
ccaacagttggtttggtgtctcccataagtatcaatttaagtgatattcagaatgtactt
aaagtggcggtagatggtaatgtaataaggcaagtgttggagaataatcaagccaatctt
gcatccaaagaacaagaaacaatcaatgcttcacccatacaacaaggtggccattctgtt
atttcagccatcagtcttcctttggttgatcaagatggaacaaccaaaattatcatcaac
tacagtcttgagcagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaat
ccagtcgctacaaacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtct
gagaaggacaaaagctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgat
tgtccaggagatattaatgcacttccagaattaaagcactatgacctaaagcagcctact
cagcctcctccactccctgcagcagaagctgagaagcctgagtcctctgtttcatcagct
actggagatggcaatttgtctcctagtcagccacctttaaagaacctcttgtctctccta
aaagcatattatgctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgat
tcagtaaacctaccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacag
atttcagtgcagtcttctgaaccatcttctcctgaaccaggcaaagtaaatatccctgcc
aagaacaatgatcagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaat
ctacaaagtcctttgaagatgactaactccccagttttaccagtgggatcaaccaccaat
ggttccagaagtagtacaccatccccatcacctctaaacctttcctcatccagaaataca
cagggttacttgtacacagctgagggtgcacaagaagagccacaagtagaacctcttgat
ctttcactaccaaagcaacagggagaattattagaaaggtcaactatcactagtgtttac
cagaacagtgtttattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggag
ccacaaaaggacagttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagt
gccaaccccataaatatcgctatacctacagtcactgcccagttacccacaatcgtggcc
attgctgaccagaacagtgttccatgcttaagagcgctagctgccaataagcaaacgatt
ctgattccccaggtggcatacacctactcaactacggtcagccctgcagtccaagaacca
cccttgaaagtgatccagccaaatggaaatcaggatgaaagacaagatactagctcagaa
ggagtatcaaatgtagaggatcagaatgactctgattctacaccgcccaaaaagaaaatg
cggaagacagaaaatggaatgtatgcttgtgatttgtgtgacaagatattccaaaagagt
agttcattattgagacataaatatgaacacacaggtaaaagacctcatgagtgtggaatc
tgtaaaaaggcatttaaacacaaacatcatttgattgaacacatgcgattacattctgga
gaaaagccctatcaatgtgacaaatgtggaaagcgcttctcacactctgggtcttattct
caacacatgaatcatcgctactcctactgtaagagagaagcggaagaacgtgacagcaca
gagcaggaagaggcagggcctgaaatcctctcgaatgagcacgtgggtgccagggcgtct
ccctcacagggcgactcggacgagagagagagtttgacaagggaagaggatgaagacagt
gaaaaagaggaagaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgt
gaaaaaccacaaggggatgaggaagaggaggaggaggaggaagaagtggaagaagaagag
gtagaagaggcagagaatgagggagaagaagcaaaaactgaaggtctgatgaaggatgac
agggctgaaagtcaagcaagcagcttaggacaaaaagtaggcgagagtagtgagcaagtg
tctgaagaaaagacaaatgaagcctaa

Protein Sequence

>6935 : length: 1108
MKVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREG
NAKNCWEDDTGKEGQEILGPEAQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTA
VIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKN
EDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLK
EHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSL
SASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFT
GGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANL
ASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEN
PVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPT
QPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIAD
SVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVN
LQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLD
LSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVIPPS
ANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEP
PLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKS
SSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYS
QHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDS
EKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDD
RAESQASSLGQKVGESSEQVSEEKTNEA



')