Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6932

Name

TCF7

Synonym

TCF-1;transcription factor 7 (T-cell specific, HMG-box);TCF7;transcription factor 7 (T-cell specific, HMG-box)

Definition

T-cell-specific transcription factor 1|transcription factor 7

Position

5q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

IMMUNE;GAD

Disease

diabetes, type 1;GAD

External Links

Links to Entrez Gene

6932

Links to all GeneRIF Items

6932

Links to iHOP

6932

Sequence Information

Nucleotide Sequence

>6932 : length: 810
atgtacaaagagaccgtctactccgccttcaatctgctcatgcattacccacccccctcg
ggagcagggcagcacccccagccgcagcccccgctgcacaaggccaatcagcccccccac
ggtgtcccccaactctctctctacgaacatttcaacagcccacatcccacccctgcacct
gcggacatcagccagaagcaagttcacaggcctctgcagacccctgacctctctggcttc
tactccctgacctcaggcagcatggggcagctcccccacactgtgagctggttcacccac
ccatccttgatgctaggttctggtgtacctggtcacccagcagccatcccccacccggcc
attgtgcccccctcagggaagcaggagctgcagcccttcgaccgcaacctgaagacacaa
gcagagtccaaggcagagaaggaggccaagaagccaaccatcaagaagcccctcaatgcc
ttcatgctgtacatgaaggagatgagagccaaggtcattgcagagtgcacacttaaggag
agcgctgccatcaaccagatcctgggccgcaggtggcacgcgctgtcgcgagaagagcag
gccaagtactatgagctggcccgcaaggagaggcagctgcacatgcagctatacccaggc
tggtcagcgcgggacaactacgggaagaagaagaggcggtcgagggaaaagcaccaagaa
tccaccacagagacaaactggcccagagaactcaaggatggtaatggacaagagtcactg
tccatgtcttcttcctctagcccagcttga

Protein Sequence

>6932 : length: 269
MYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAP
ADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPA
IVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKE
SAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQE
STTETNWPRELKDGNGQESLSMSSSSSPA



')