Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6926

Name

TBX3

Synonym

TBX3-ISO|UMS|XHL;T-box 3;TBX3;T-box 3

Definition

T-box protein 3|T-box transcription factor TBX3|bladder cancer related protein XHL

Position

12q24.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

6926

Links to all GeneRIF Items

6926

Links to iHOP

6926

Sequence Information

Nucleotide Sequence

>6926 : length: 2172
atgagcctctccatgagagatccggtcattcctgggacaagcatggcctaccatccgttc
ctacctcaccgggcgccggacttcgccatgagcgcggtgctgggtcaccagccgccgttc
ttccccgcgctgacgctgcctcccaacggcgcggcggcgctctcgctgccgggcgccctg
gccaagccgatcatggatcaattggtgggggcggccgagaccggcatcccgttctcctcc
ctggggccccaggcgcatctgaggcctttgaagaccatggagcccgaagaagaggtggag
gacgaccccaaggtgcacctggaggctaaagaactttgggatcagtttcacaagcggggc
accgagatggtcattaccaagtcgggaaggcgaatgtttcctccatttaaagtgagatgt
tctgggctggataaaaaagccaaatacattttattgatggacattatagctgctgatgac
tgtcgttataaatttcacaattctcggtggatggtggctggtaaggccgaccccgaaatg
ccaaagaggatgtacattcacccggacagccccgctactggggaacagtggatgtccaaa
gtcgtcactttccacaaactgaaactcaccaacaacatttcagacaaacatggatttact
atattgaactccatgcacaaataccagccccggttccacattgtaagagccaatgacatc
ttgaaactcccttatagtacatttcggacatacttgttccccgaaactgaattcatcgct
gtgactgcataccagaatgataagataacccagttaaaaatagacaacaacccttttgca
aaaggtttccgggacactggaaatggccgaagagaaaaaagaaaacagctcaccctgcag
tccatgagggtgtttgatgaaagacacaaaaaggagaatgggacctctgatgagtcctcc
agtgaacaagcagctttcaactgcttcgcccaggcttcttctccagccgcctccactgta
gggacatcgaacctcaaagatttatgtcccagcgagggtgagagcgacgccgaggccgag
agcaaagaggagcatggccccgaggcctgcgacgcggccaagatctccaccaccacgtcg
gaggagccctgccgtgacaagggcagccccgcggtcaaggctcaccttttcgctgctgag
cggccccgggacagcgggcggctggacaaagcgtcgcccgactcacgccatagccccgcc
accatctcgtccagcactcgcggcctgggcgcggaggagcgcaggagcccggttcgcgag
ggcacagcgccggccaaggtggaagaggcgcgcgcgctcccgggcaaggaggccttcgcg
ccgctcacggtgcagacggacgcggccgccgcgcacctggcccagggccccctgcctggc
ctcggcttcgccccgggcctggcgggccaacagttcttcaacgggcacccgctcttcctg
caccccagccagtttgccatggggggcgccttctccagcatggcggccgctggcatgggt
cccctcctggccacggtttctggggcctccaccggtgtctcgggcctggattccacggcc
atggcctctgccgctgcggcgcagggactgtccggggcgtccgcggccaccctgcccttc
cacctccagcagcacgtcctggcctctcagggcctggccatgtcccctttcggaagcctg
ttcccttacccctacacgtacatggccgcagcggcggccgcctcctctgcggcagcctcc
agctcggtgcaccgccaccccttcctcaatctgaacaccatgcgcccgcggctgcgctac
agcccctactccatcccggtgccggtcccggacggcagcagtctgctcaccaccgccctg
ccctccatggcggcggccgcggggcccctggacggcaaagtcgccgccctggccgccagc
ccggcctcggtggcagtggactcgggctctgaactcaacagccgctcctccacgctctcc
tccagctccatgtccttgtcgcccaaactctgcgcggagaaagaggcggccaccagcgaa
ctgcagagcatccagcggttggttagcggcttggaagccaagccggacaggtcccgcagc
gcgtccccgtag

Protein Sequence

>6926 : length: 723
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDI
LKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQ
SMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAE
SKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDKASPDSRHSPA
TISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAAAHLAQGPLPG
LGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTA
MASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAAS
SSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAAS
PASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRS
ASP



')