Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6925

Name

TCF4

Synonym

E2-2|ITF-2|ITF2|PTHS|SEF-2|SEF2|SEF2-1|SEF2-1A|SEF2-1B|TCF-4|bHLHb19;transcription factor 4;TCF4;transcription factor 4

Definition

SL3-3 enhancer factor 2|class B basic helix-loop-helix protein 19|immunoglobulin transcription factor 2

Position

18q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Myogenesis;Reactome;REACT:21303

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Disease

Fuch's corneal dystrophy;NHGRI

Disease

Pitt-Hopkins syndrome;OMIM

Disease

PSYCH;GAD

Disease

Schizophrenia;NHGRI

Disease

schizophrenia;GAD

External Links

Links to Entrez Gene

6925

Links to all GeneRIF Items

6925

Links to iHOP

6925

Sequence Information

Nucleotide Sequence

>6925 : length: 2016
atgcatcaccaacagcgaatggctgccttagggacggacaaagagctgagtgatttactg
gatttcagtgcgatgttttcacctcctgtgagcagtgggaaaaatggaccaacttctttg
gcaagtggacattttactggctcaaatgtagaagacagaagtagctcagggtcctggggg
aatggaggacatccaagcccgtccaggaactatggagatgggactccctatgaccacatg
accagcagggaccttgggtcacatgacaatctctctccaccttttgtcaattccagaata
caaagtaaaacagaaaggggctcatactcatcttatgggagagaatcaaacttacagggt
tgccaccagcagagtctccttggaggtgacatggatatgggcaacccaggaaccctttcg
cccaccaaacctggttcccagtactatcagtattctagcaataatccccgaaggaggcct
cttcacagtagtgccatggaggtacagacaaagaaagttcgaaaagttcctccaggtttg
ccatcttcagtctatgctccatcagcaagcactgccgactacaatagggactcgccaggc
tatccttcctccaaaccagcaaccagcactttccctagctccttcttcatgcaagatggc
catcacagcagtgacccttggagctcctccagtgggatgaatcagcctggctatgcagga
atgttgggcaactcttctcatattccacagtccagcagctactgtagcctgcatccacat
gaacgtttgagctatccatcacactcctcagcagacatcaattccagtcttcctccgatg
tccactttccatcgtagtggtacaaaccattacagcacctcttcctgtacgcctcctgcc
aacgggacagacagtataatggcaaatagaggaagcggggcagccggcagctcccagact
ggagatgctctggggaaagcacttgcttcgatctattctccagatcacactaacaacagc
ttttcatcaaacccttcaactcctgttggctctcctccatctctctcagcaggcacagct
gtttggtctagaaatggaggacaggcctcatcgtctcctaattatgaaggacccttacac
tctttgcaaagccgaattgaagatcgtttagaaagactggatgatgctattcatgttctc
cggaaccatgcagtgggcccatccacagctatgcctggtggtcatggggacatgcatgga
atcattggaccttctcataatggagccatgggtggtctgggctcagggtatggaaccggc
cttctttcagccaacagacattcactcatggtggggacccatcgtgaagatggcgtggcc
ctgagaggcagccattctcttctgccaaaccaggttccggttccacagcttcctgtccag
tctgcgacttcccctgacctgaacccaccccaggacccttacagaggcatgccaccagga
ctacaggggcagagtgtctcctctggcagctctgagatcaaatccgatgacgagggtgat
gagaacctgcaagacacgaaatcttcggaggacaagaaattagatgacgacaagaaggat
atcaaatcaattactaggtcaagatctagcaataatgacgatgaggacctgacaccagag
cagaaggcagagcgtgagaaggagcggaggatggccaacaatgcccgagagcgtctgcgg
gtccgtgacatcaacgaggctttcaaagagctcggccgcatggtgcagctccacctcaag
agtgacaagccccagaccaagctcctgatcctccaccaggcggtggccgtcatcctcagt
ctggagcagcaagtccgagaaaggaatctgaatccgaaagctgcgtgtctgaaaagaagg
gaggaagagaaggtgtcctcagagcctccccctctctccttggccggcccacaccctgga
atgggagacgcatcgaatcacatgggacagatgtaa

Protein Sequence

>6925 : length: 671
MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG
NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG
CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL
PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG
MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA
VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ
SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
IKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLK
SDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPG
MGDASNHMGQM



')