Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6909

Name

TBX2

Synonym

-;T-box 2;TBX2;T-box 2

Definition

T-box protein 2|T-box transcription factor TBX2

Position

17q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Disease

DEVELOPMENTAL;GAD

Disease

Serum creatinine;NHGRI

Disease

height;GAD

External Links

Links to Entrez Gene

6909

Links to all GeneRIF Items

6909

Links to iHOP

6909

Sequence Information

Nucleotide Sequence

>6909 : length: 2139
atgagagagccggcgctggcggccagcgccatggcttaccacccgttccacgcgccacgg
cccgccgacttccccatgtccgcctttctggcggcggcgcagccctccttcttcccggca
ctcgcgctgccgcccggcgcgctggccaagccgctgcccgacccgggcctggcgggggcg
gcggccgcggcggcggcggcggcagcagcggccgaggcggggctgcacgtctcggcactg
ggcccgcacccgcccgccgcgcatctgcgctccctcaagagcctggagcccgaggacgag
gtggaggacgaccccaaggtgacgctggaggccaaggagctgtgggaccagttccacaag
ctaggcacggagatggtcatcaccaagtccgggaggcggatgttcccccccttcaaggtg
cgagtcagcggcctggacaagaaggccaagtatatcctgctgatggacattgtagccgct
gacgattgccgctataagttccacaactcgcgctggatggtggcgggcaaggccgaccct
gagatgcccaaacgcatgtacatccacccagacagcccagccacgggggagcagtggatg
gctaagcctgtggccttccacaagctgaagctgaccaacaacatctctgacaagcacggc
ttcaccatcctaaactccatgcacaagtaccagccgcgcttccacatagtgcgagccaac
gacatcctgaagctgccttacagcaccttccgcacctacgtgttcccggagaccgacttc
atcgccgtcactgcctaccagaatgacaagatcacacagctgaagatcgacaacaacccg
tttgccaagggcttccgggacaccgggaacggccggcgggagaaaaggaagcagctgacg
ctgccgtctctacgcttgtacgaggagcactgcaaacccgagcgcgatggcgcggagtca
gacgcctcgtcgtgcgaccctccccccgcgcgggaaccacccacctccccgggcgcagcg
cccagtccgctgcgcctgcaccgggcccgagctgaggagaagtcgtgcgccgcggacagc
gacccggagcctgagcggttgagcgaggagcgtgcgggggcgccgctaggccgcagcccg
gctccagacagcgccagccccactcgcttgaccgaacccgagcgcgcccgggagcggcgt
agtcccgagaggggcaaggagccggccgagagcggcggggacggcccgttcggcctgagg
agcctggagaaggagcgcgccgaagctcggaggaaggacgaggggcgcaaggaggcggcc
gagggcaaggagcagggcctggcgccgctggtggtgcagacagacagtgcgtcccccctg
ggcgccggacacctgcccggcctggccttttccagccacttgcacgggcagcagttcttt
gggccgctgggagccggccagccgctcttcctgcaccctggacagttcaccatgggccct
ggcgccttctccgccatgggcatgggtcacctactggcctcggtggcaggcggcggcaac
ggcggaggtggcgggcctgggaccgccgcggggctggacgcaggcgggctgggtcccgcg
gccagcgcagcaagcaccgccgcgcccttcccgttccacctctcccagcacatgctggca
tctcagggaattccaatgcccactttcggaggcctcttcccctacccctacacctacatg
gcagcagcagccgcagccgcctcggctttgcccgccactagtgctgcagctgccgccgcc
gcagccgccggctccctctcccggagccccttcctgggcagtgcccggccccgactgcgt
ttcagcccctatcagatcccggtcaccatcccgcctagcactagcctcctcaccaccggg
ctggcctctgagggctccaaggccgctggtggaaacagccgggagcctagccccctgccc
gagctggctctccgcaaagtaggggccccatcccgcggtgccctgtcgcccagtggctcg
gccaaggaggcggccaatgaactgcagagcatccagagactggtgagtgggctggagagc
cagcgagccctctccccaggccgggagtcgcccaagtga

Protein Sequence

>6909 : length: 712
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGA
AAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK
LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADP
EMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN
DILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRARAEEKSCAADS
DPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
GPLGAGQPLFLHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPA
ASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLP
ELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK



')