Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6885

Name

MAP3K7

Synonym

MEKK7|TAK1|TGF1a;mitogen-activated protein kinase kinase kinase 7;MAP3K7;mitogen-activated protein kinase kinase kinase 7

Definition

TGF-beta activated kinase 1|TGF-beta-activated kinase 1|transforming growth factor-beta-activated kinase 1

Position

6q15

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Downstream TCR signaling;PID Reactome;500482

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

JNK signaling in the CD4+ TCR pathway;PID Curated;200129

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

TRAF6 Mediated Induction of the antiviral cytokine IFN-alpha/beta cascade;PID Reactome;500449

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Disease

IMMUNE;GAD

Disease

Celiac Disease;GAD

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

External Links

Links to Entrez Gene

6885

Links to all GeneRIF Items

6885

Links to iHOP

6885

Sequence Information

Nucleotide Sequence

>6885 : length: 1740
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacaggcaacggacagccaagacgtagatccatccaagacttgactgtaactgga
acagaacctggtcaggtgagcagtaggtcatccagtcccagtgtcagaatgattactacc
tcaggaccaacctcagaaaagccaactcgaagtcatccatggacccctgatgattccaca
gataccaatggatcagataactccatcccaatggcttatcttacactggatcaccaacta
cagcctctagcaccgtgcccaaactccaaagaatctatggcagtgtttgaacagcattgt
aaaatggcacaagaatatatgaaagttcaaacagaaattgcattgttattacagagaaag
caagaactagttgcagaactggaccaggatgaaaaggaccagcaaaatacatctcgcctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttctacttactaccagcaa
tgcaaaaaacaactagaggtcatcagaagtcagcagcagaaacgacaaggcacttcatga

Protein Sequence

>6885 : length: 579
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS



')