Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6868

Name

ADAM17

Synonym

ADAM18|CD156B|CSVP|NISBD|TACE;ADAM metallopeptidase domain 17;ADAM17;ADAM metallopeptidase domain 17

Definition

ADAM metallopeptidase domain 18|TNF-alpha convertase|TNF-alpha converting enzyme|disintegrin and metalloproteinase domain-containing protein 17|snake venom-like protease|tumor necrosis factor, alpha, converting enzyme

Position

2p25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

g-secretase mediated erbb4 signaling pathway;PID BioCarta;100172

Pathway

segmentation clock;PID BioCarta;100146

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

proteolysis and signaling pathway of notch;PID BioCarta;100091

External Links

Links to Entrez Gene

6868

Links to all GeneRIF Items

6868

Links to iHOP

6868

Sequence Information

Nucleotide Sequence

>6868 : length: 2475
atgaggcagtctctcctattcctgaccagcgtggttcctttcgtgctggcgccgcgacct
ccggatgacccgggcttcggcccccaccagagactcgagaagcttgattctttgctctca
gactacgatattctctctttatctaatatccagcagcattcggtaagaaaaagagatcta
cagacttcaacacatgtagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacctgacatcaagtactgaacgtttttcacaaaatttcaaggtcgtggtggtggat
ggtaaaaacgaaagcgagtacactgtaaaatggcaggacttcttcactggacacgtggtt
ggtgagcctgactctagggttctagcccacataagagatgatgatgttataatcagaatc
aacacagatggggccgaatataacatagagccactttggagatttgttaatgataccaaa
gacaaaagaatgttagtttataaatctgaagatatcaagaatgtttcacgtttgcagtct
ccaaaagtgtgtggttatttaaaagtggataatgaagagttgctcccaaaagggttagta
gacagagaaccacctgaagagcttgttcatcgagtgaaaagaagagctgacccagatccc
atgaagaacacgtgtaaattattggtggtagcagatcatcgcttctacagatacatgggc
agaggggaagagagtacaactacaaattacttaatagagctaattgacagagttgatgac
atctatcggaacacttcatgggataatgcaggttttaaaggctatggaatacagatagag
cagattcgcattctcaagtctccacaagaggtaaaacctggtgaaaagcactacaacatg
gcaaaaagttacccaaatgaagaaaaggatgcttgggatgtgaagatgttgctagagcaa
tttagctttgatatagctgaggaagcatctaaagtttgcttggcacaccttttcacatac
caagattttgatatgggaactcttggattagcttatgttggctctcccagagcaaacagc
catggaggtgtttgtccaaaggcttattatagcccagttgggaagaaaaatatctatttg
aatagtggtttgacgagcacaaagaattatggtaaaaccatccttacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgatccggatggtcta
gcagaatgtgccccgaatgaggaccagggagggaaatatgtcatgtatcccatagctgtg
agtggcgatcacgagaacaataagatgttttcaaactgcagtaaacaatcaatctataag
accattgaaagtaaggcccaggagtgttttcaagaacgcagcaataaagtttgtgggaac
tcgagggtggatgaaggagaagagtgtgatcctggcatcatgtatctgaacaacgacacc
tgctgcaacagcgactgcacgttgaaggaaggtgtccagtgcagtgacaggaacagtcct
tgctgtaaaaactgtcagtttgagactgcccagaagaagtgccaggaggcgattaatgct
acttgcaaaggcgtgtcctactgcacaggtaatagcagtgagtgcccgcctccaggaaat
gctgaagatgacactgtttgcttggatcttggcaagtgtaaggatgggaaatgcatccct
ttctgcgagagggaacagcagctggagtcctgtgcatgtaatgaaactgacaactcctgc
aaggtgtgctgcagggacctttctggccgctgtgtgccctatgtcgatgctgaacaaaag
aacttatttttgaggaaaggaaagccctgtacagtaggattttgtgacatgaatggcaaa
tgtgagaaacgagtacaggatgtaattgaacgattttgggatttcattgaccagctgagc
atcaatacttttggaaagtttttagcagacaacatcgttgggtctgtcctggttttctcc
ttgatattttggattcctttcagcattcttgtccattgtgtggataagaaattggataaa
cagtatgaatctctgtctctgtttcaccccagtaacgtcgaaatgctgagcagcatggat
tctgcatcggttcgcattatcaaaccctttcctgcgccccagactccaggccgcctgcag
cctgcccctgtgatcccttcggcgccagcagctccaaaactggaccaccagagaatggac
accatccaggaagaccccagcacagactcacatatggacgaggatgggtttgagaaggac
cccttcccaaatagcagcacagctgccaagtcatttgaggatctcacggaccatccggtc
accagaagtgaaaaggctgcctcctttaaactgcagcgtcagaatcgtgttgacagcaaa
gaaacagagtgctaa

Protein Sequence

>6868 : length: 824
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC



')