Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6794

Name

STK11

Synonym

LKB1|PJS|hLKB1;serine/threonine kinase 11;STK11;serine/threonine kinase 11

Definition

liver kinase B1|polarization-related protein LKB1|renal carcinoma antigen NY-REN-19|serine/threonine-protein kinase 11|serine/threonine-protein kinase LKB1|serine/threonine-protein kinase STK11

Position

19p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

AMPK inhibits chREBP transcriptional activation activity;PID Reactome;500719

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

Activated AMPK stimulates fatty-acid oxidation in muscle;Reactome;REACT:11163

Pathway

Regulation of AMPK activity via LKB1;PID Reactome;500502

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Disease

Peutz-Jeghers syndrome;GAD

Disease

Melanoma, malignant sporadic;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Testicular tumor, sporadic;OMIM

Disease

Pancreatic cancer;KEGG DISEASE;H00019

Disease

Peutz-Jegher's syndrome;GAD

Disease

Peutz-Jeghers syndrome;OMIM

Disease

Pancreatic cancer, sporadic;OMIM

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

DEVELOPMENTAL;GAD

External Links

Links to Entrez Gene

6794

Links to all GeneRIF Items

6794

Links to iHOP

6794

Sequence Information

Nucleotide Sequence

>6794 : length: 1302
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg
aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca
ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc
cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg
cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat
ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg
agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc
agcagcaagatccgccggctgtcggcctgcaagcagcagtga

Protein Sequence

>6794 : length: 433
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ



')