Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6790

Name

AURKA

Synonym

AIK|ARK1|AURA|AURORA2|BTAK|PPP1R47|STK15|STK6|STK7;aurora kinase A;AURKA;aurora kinase A

Definition

ARK-1|IPL1-related kinase|aurora 2|aurora-related kinase 1|aurora/IPL1-like kinase|aurora/IPL1-related kinase 1|breast tumor-amplified kinase|breast-tumor-amplified kinase|hARK1|protein phosphatase 1, regulatory subunit 47|serine/threonine kinase 6|serine

Position

20q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Aurora B signaling;PID Curated;200010

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

role of ran in mitotic spindle regulation;PID BioCarta;100051

Pathway

Aurora A signaling;PID Curated;200166

Pathway

Signaling by Aurora kinases;PID Curated;200047

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

esophageal cancer;GAD

Disease

breast cancer;GAD

Disease

overall effect;GAD

Disease

CANCER;GAD

Disease

pancreatic cancer;GAD

Disease

Colon cancer, susceptibility to;OMIM

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

6790

Links to all GeneRIF Items

6790

Links to iHOP

6790

Sequence Information

Nucleotide Sequence

>6790 : length: 1212
atggaccgatctaaagaaaactgcatttcaggacctgttaaggctacagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgtaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcttcccagcgcattcctttgcaa
gcacaaaagcttgtctccagtcacaagccggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccactgaataacacccaaaagagcaagcag
cccctgccatcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaagcaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtagaaatacagtcccaccttcggcatcctaatattcttagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtttataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacttatataacagaattg
gcaaatgccctgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gaatttttagttgggaagcctccttttgaggcaaacacataccaagagacctacaaaaga
atatcacgggttgaattcacattccctgactttgtaacagagggagccagggacctcatt
tcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaacac
ccctggatcacagcaaattcatcaaaaccatcaaattgccaaaacaaagaatcagctagc
aaacagtcttag

Protein Sequence

>6790 : length: 403
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS



')