Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6777

Name

STAT5B

Synonym

STAT5;signal transducer and activator of transcription 5B;STAT5B;signal transducer and activator of transcription 5B

Definition

transcription factor STAT5B

Position

17q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

JAK/STAT signaling pathway;PANTHER;P00038

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

il22 soluble receptor signaling pathway;PID BioCarta;100131

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Leukemia, acute promyelocytic, STAT5B/RARA type;OMIM

Disease

Growth hormone insensitivity with immunodeficiency;OMIM

External Links

Links to Entrez Gene

6777

Links to all GeneRIF Items

6777

Links to iHOP

6777

Sequence Information

Nucleotide Sequence

>6777 : length: 2364
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttatatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcagtagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagccaacaatggtagctctccagctggaagccttgctgatgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacgcaggacacagagaat
gagttaaaaaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacgttcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgcgtcatggagtaccaccaagccacaggcacccttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcggtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacggcc
actgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtctgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctcctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagctgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgccgggggc
ggcagcgccacgtacatggaccaggccccctccccagctgtgtgtccccaggctcactat
aacatgtacccacagaaccctgactcagtccttgacaccgatggggacttcgatctggag
gacacaatggacgtagcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccgcacgcacaatcgtga

Protein Sequence

>6777 : length: 787
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS



')