Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6776

Name

STAT5A

Synonym

MGF|STAT5;signal transducer and activator of transcription 5A;STAT5A;signal transducer and activator of transcription 5A

Definition

-

Position

17q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

JAK/STAT signaling pathway;PANTHER;P00038

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

il22 soluble receptor signaling pathway;PID BioCarta;100131

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

External Links

Links to Entrez Gene

6776

Links to all GeneRIF Items

6776

Links to iHOP

6776

Sequence Information

Nucleotide Sequence

>6776 : length: 2385
atggcgggctggatccaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccggcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaaaacatatgaccgc
tgccccctggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctctccggctgggatcctggttgacgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaaactgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgcccagctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtacgcctgctggtgggcgggaagctg
aacgtgcacatgaatcccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgcttaaaaatgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagtgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacggct
actgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccacgacctgctcatcaacaagcccgacgggaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacgcgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactcctgtgctggctaaagctgttgatggatatgtgaaaccacagatcaag
caagtggtccctgagtttgtgaatgcatctgcagatgctgggggcagcagcgccacgtac
atggaccaggccccctccccagctgtgtgcccccaggctccctataacatgtacccacag
aaccctgaccatgtactcgatcaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccaatggacagtcttgactcccgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

Protein Sequence

>6776 : length: 794
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS



')