Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6722

Name

SRF

Synonym

MCM1;serum response factor (c-fos serum response element-binding transcription factor);SRF;serum response factor (c-fos serum response element-binding transcription factor)

Definition

serum response factor

Position

6p21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

hop pathway in cardiac development;PID BioCarta;100143

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

growth hormone signaling pathway;PID BioCarta;100155

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Ras Pathway;PANTHER;P04393

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

External Links

Links to Entrez Gene

6722

Links to all GeneRIF Items

6722

Links to iHOP

6722

Sequence Information

Nucleotide Sequence

>6722 : length: 1527
atgttaccgacccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggcggcggcggcgggacacgcggggctaac
gggggccgggtccccgggaatggcgcggggctcgggcccggccgcctggagcgggaggct
gcggcagcggcggcaaccaccccggcgcccaccgcgggggccctctacagcggcagcgag
ggcgactcggagtcgggcgaggaggaggagctgggcgccgagcggcgcggcctgaagcgg
agcctgagcgagatggagatcggtatggtggtcggtgggcccgaggcgtcggcagcggcc
accgggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaagacc
cggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacgacc
ttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgccacccga
aaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgttcagaccccacaacagaccagagaatgagtgccactggc
tttgaagagacagatctcacctaccaggtgtcggagtctgacagcagtggggagaccaag
gacacactgaagccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaa
acagcacctagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatcacc
aactacctggcaccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatggg
actgtgctgaagagtacaggcagcggccctgtctcctctgggggccttatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caagtgcaccaggccccacagcaagcgtctccctcccgtgacagcagcacagacctcacg
cagacctcctccagcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgccc
acaactgtgggtggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacc
tcgggcctgggtgatggcagcctcaccgtgctgaatgccttctcccaggcaccatccacc
atgcaggtgtcacacagccaggtccaggagccaggtggcgtcccccaggtgttcctgaca
gcatcatctgggacagtgcagatccctgtttcagcagttcagctccaccagatggctgtg
atagggcagcaggccgggagcagcagcaacctcaccgagctacaggtggtgaacctggac
accgcccacagcaccaagagtgaatga

Protein Sequence

>6722 : length: 508
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE



')