Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6714

Name

SRC

Synonym

ASV|SRC1|c-SRC|p60-Src;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian);SRC;v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)

Definition

proto-oncogene c-Src|proto-oncogene tyrosine-protein kinase Src|protooncogene SRC, Rous sarcoma|tyrosine kinase pp60c-src|tyrosine-protein kinase SRC-1

Position

20q12-q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Pathway

regulation of splicing through sam68;PID BioCarta;100036

Pathway

Glypican 1 network;PID Curated;200021

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Endothelins;PID Curated;200004

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

ADP signalling through P2Y purinoceptor 1;PID Reactome;500292

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230

Pathway

p38MAPK events;PID Reactome;500627

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Recycling pathway of L1;PID Reactome;500098

Pathway

Membrane Trafficking;Reactome;REACT:11123

Pathway

cbl mediated ligand-induced downregulation of egf receptors pathway;PID BioCarta;100216

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

pelp1 modulation of estrogen receptor activity;PID BioCarta;100076

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

c-src mediated regulation of Cx43 function and closure of gap junctions;PID Reactome;500026

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

Integrin alphaIIbbeta3 signaling;PID Reactome;500005

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Signaling by EGFR;PID Reactome;500510

Pathway

Netrin mediated repulsion signals;PID Reactome;500090

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

gamma-aminobutyric acid receptor life cycle pathway;PID BioCarta;100158

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

NCAM signaling for neurite out-growth;PID Reactome;500079

Pathway

Hemostasis;Reactome;REACT:604

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Down-stream signal transduction;PID Reactome;500509

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

SHC-mediated cascade;PID Reactome;500250

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Parkinson disease;PANTHER;P00049

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Colon cancer, advanced;OMIM

External Links

Links to Entrez Gene

6714

Links to all GeneRIF Items

6714

Links to iHOP

6714

Sequence Information

Nucleotide Sequence

>6714 : length: 1611
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggccgactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

Protein Sequence

>6714 : length: 536
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL



')