Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6700

Name

SPRR2A

Synonym

-;small proline-rich protein 2A;SPRR2A;small proline-rich protein 2A

Definition

2-1|SPR-2A

Position

1q21-q22

Gene Type

protein-coding

External Links

Links to Entrez Gene

6700

Links to all GeneRIF Items

6700

Links to iHOP

6700

Sequence Information

Nucleotide Sequence

>6700 : length: 219
atgtcttatcaacagcagcagtgcaagcagccctgccagccacctcctgtgtgccccacg
ccaaagtgcccagagccatgtccacccccgaagtgccctgagccctgcccaccaccaaag
tgtccacagccctgcccacctcagcagtgccagcagaaatatcctcctgtgacaccttcc
ccaccctgccagtcaaagtatccaccgaagagcaagtaa

Protein Sequence

>6700 : length: 72
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPS
PPCQSKYPPKSK



')