Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6696

Name

SPP1

Synonym

BNSP|BSPI|ETA-1|OPN;secreted phosphoprotein 1;SPP1;secreted phosphoprotein 1

Definition

SPP1/CALPHA1 fusion|bone sialoprotein 1|early T-lymphocyte activation 1|nephropontin|osteopontin|osteopontin-C|osteopontin-D|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein|secreted phosphoprotein 1 (osteopontin, bone sialopr

Position

4q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

regulators of bone mineralization;PID BioCarta;100089

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Lupus erythematosus;FunDO

Disease

Biliary Atresia;FunDO

Disease

pseudoxanthoma elasticum;GAD

Disease

Hepatitis C;FunDO

Disease

Cancer;FunDO

Disease

Eating disorder;FunDO

Disease

HIV infection;FunDO

Disease

Ulcerative colitis;FunDO

Disease

Parkinson disease;FunDO

Disease

intima-media thickness;GAD

Disease

Herpes;FunDO

Disease

Pancreatitis;FunDO

Disease

IMMUNE;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Inflammation of the central nervous system;FunDO

Disease

rheumatoid arthritis;GAD

Disease

systemic lupus erythematosus;GAD

Disease

Nephrolithiasis;GAD

Disease

Dental plaque;FunDO

Disease

METABOLIC;GAD

Disease

Diabetes mellitus;FunDO

Disease

asthma IgE;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Multiple sclerosis;FunDO

Disease

CANCER;GAD

Disease

Carotid Artery Diseases;GAD

Disease

Kidney failure;FunDO

Disease

hepatitis B liver cancer;GAD

Disease

Heart failure;FunDO

Disease

Enteritis;FunDO

Disease

Osteoporosis;FunDO

Disease

Lupus vulgaris;FunDO

Disease

Obesity;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

6696

Links to all GeneRIF Items

6696

Links to iHOP

6696

Sequence Information

Nucleotide Sequence

>6696 : length: 903
atgagaattgcagtgatttgcttttgcctcctaggcatcacctgtgccataccagttaaa
caggctgattctggaagttctgaggaaaagcagctttacaacaaatacccagatgctgtg
gccacatggctaaaccctgacccatctcagaagcagaatctcctagccccacagaccctt
ccaagtaagtccaacgaaagccatgaccacatggatgatatggatgatgaagatgatgat
gaccatgtggacagccaggactccattgactcgaacgactctgatgatgtagatgacact
gatgattctcaccagtctgatgagtctcaccattctgatgaatctgatgaactggtcact
gattttcccacggacctgccagcaaccgaagttttcactccagttgtccccacagtagac
acatatgatggccgaggtgatagtgtggtttatggactgaggtcaaaatctaagaagttt
cgcagacctgacatccagtaccctgatgctacagacgaggacatcacctcacacatggaa
agcgaggagttgaatggtgcatacaaggccatccccgttgcccaggacctgaacgcgcct
tctgattgggacagccgtgggaaggacagttatgaaacgagtcagctggatgaccagagt
gctgaaacccacagccacaagcagtccagattatataagcggaaagccaatgatgagagc
aatgagcattccgatgtgattgatagtcaggaactttccaaagtcagccgtgaattccac
agccatgaatttcacagccatgaagatatgctggttgtagaccccaaaagtaaggaagaa
gataaacacctgaaatttcgtatttctcatgaattagatagtgcatcttctgaggtcaat
taa

Protein Sequence

>6696 : length: 300
MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTL
PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVT
DFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHME
SEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDES
NEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN



')