Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6667

Name

SP1

Synonym

-;Sp1 transcription factor;SP1;Sp1 transcription factor

Definition

specificity protein 1|transcription factor Sp1

Position

12q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

effects of calcineurin in keratinocyte differentiation;PID BioCarta;100222

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

overview of telomerase rna component gene hterc transcriptional regulation;PID BioCarta;100020

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

C-MYB transcription factor network;PID Curated;200130

Disease

Herpes;FunDO

Disease

Thrombophlebitis;FunDO

Disease

Cystic fibrosis;FunDO

Disease

Keratoconus;FunDO

Disease

Corneal disease;FunDO

Disease

Cancer;FunDO

Disease

Schizophrenia;FunDO

Disease

Yersinia infection;FunDO

Disease

Alzheimer's disease;FunDO

External Links

Links to Entrez Gene

6667

Links to all GeneRIF Items

6667

Links to iHOP

6667

Sequence Information

Nucleotide Sequence

>6667 : length: 2337
atggatgaaatgacagctgtggtgaaaattgaaaaaggagttggtggcaataatgggggc
aatggtaatggtggtggtgccttttcacaggctcgaagtagcagcacaggcagtagcagc
agcactggaggaggagggcaggagtcccagccatcccctttggctctgctggcagcaact
tgcagcagaattgagtcacccaatgagaacagcaacaactcccagggcccgagtcagtca
gggggaacaggtgagcttgacctcacagccacacaactttcacagggtgccaatggctgg
cagatcatctcttcctcctctggggctacccctacctcaaaggaacagagtggcagcagt
accaatggcagcaatggcagtgagtcttccaagaatcgcacagtctctggtgggcagtat
gttgtggctgccgctcccaacttacagaaccagcaagttctgacaggactacctggagtg
atgcctaatattcagtatcaagtaatcccacagttccagaccgttgatgggcaacagctg
cagtttgctgccactggggcccaagtgcagcaggatggttctggtcaaatacagatcata
ccaggtgcaaaccaacagattatcacaaatcgaggaagtggaggcaacatcattgctgct
atgccaaacctactccagcaggctgtccccctccaaggcctggctaataatgtactctca
ggacagactcagtatgtgaccaatgtaccagtggccctgaatgggaacatcaccttgcta
cctgtcaacagcgtttctgcagctaccttgactcccagctctcaggcagtcacgatcagc
agctctgggtcccaggagagtggctcacagcctgtcacctcagggactaccatcagttct
gccagcttggtatcatcacaagccagttccagctcctttttcaccaatgccaatagctac
tcaactactactaccaccagcaacatgggaattatgaactttactaccagtggatcatca
gggaccaactctcaaggccagacaccccagagggtcagtgggctacaggggtctgatgct
ctgaacatccagcaaaaccagacatctggaggctcattgcaagcaggccagcaaaaagaa
ggagagcaaaaccagcagacacagcagcaacaaattcttatccagcctcagctagttcaa
gggggacaggccctccaggccctccaagcagcaccattgtcagggcagacctttacaact
caagccatctcccaggaaaccctccagaacctccagcttcaggctgttccaaactctggt
cccatcatcatccggacaccaacagtggggcccaatggacaggtcagttggcagactcta
cagctgcagaacctccaagttcagaacccacaagcccaaacaatcaccttagccccaatg
cagggtgtttccttggggcagaccagcagcagcaacaccactctcacacccattgcctca
gctgcttccattcctgctggcacagtcactgtgaatgctgctcaactctcctccatgcca
ggcctccagaccattaacctcagtgcattgggtacttcaggaatccaggtgcacccaatt
caaggcctgccgttggctatagcaaatgccccaggtgatcatggagctcagcttggtctc
catggggctggtggtgatggaatacatgatgacacagcaggtggagaggaaggagaaaac
agcccagatgcccaaccccaagccggtcggaggacccggcgggaagcatgcacctgcccc
tactgtaaagacagtgaaggaaggggctcgggggatcctggcaaaaagaaacagcatatt
tgccacatccaaggctgtgggaaagtgtatggcaagacctctcacctgcgggcacacttg
cgctggcatacaggcgagaggccatttatgtgtacctggtcatactgtgggaaacgcttc
acacgttcggatgagctacagaggcacaaacgtacacacacaggtgagaagaaatttgcc
tgccctgagtgtcctaagcgcttcatgaggagtgaccacctgtcaaaacatatcaagacc
caccagaataagaagggaggcccaggtgtagctctgagtgtgggcactttgcccctggac
agtggggcaggttcagaaggcagtggcactgccactccttcagcccttattaccaccaat
atggtagccatggaggccatctgtccagagggcattgcccgtcttgccaacagtggcatc
aacgtcatgcaggtggcagatctgcagtccattaatatcagtggcaatggcttctga

Protein Sequence

>6667 : length: 778
MDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAAT
CSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSS
TNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQL
QFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLS
GQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISS
ASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDA
LNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTT
QAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPM
QGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPI
QGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCP
YCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRF
TRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLD
SGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF



')