Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6662

Name

SOX9

Synonym

CMD1|CMPD1|SRA1;SRY (sex determining region Y)-box 9;SOX9;SRY (sex determining region Y)-box 9

Definition

SRY (sex-determining region Y)-box 9 protein|SRY-related HMG-box, gene 9|transcription factor SOX-9

Position

17q23

Gene Type

protein-coding

External Links

Links to Entrez Gene

6662

Links to all GeneRIF Items

6662

Links to iHOP

6662

Sequence Information

Nucleotide Sequence

>6662 : length: 1530
atgaatctcctggaccccttcatgaagatgaccgacgagcaggagaagggcctgtccggc
gcccccagccccaccatgtccgaggactccgcgggctcgccctgcccgtcgggctccggc
tcggacaccgagaacacgcggccccaggagaacacgttccccaagggcgagcccgatctg
aagaaggagagcgaggaggacaagttccccgtgtgcatccgcgaggcggtcagccaggtg
ctcaaaggctacgactggacgctggtgcccatgccggtgcgcgtcaacggctccagcaag
aacaagccgcacgtcaagcggcccatgaacgccttcatggtgtgggcgcaggcggcgcgc
aggaagctcgcggaccagtacccgcacttgcacaacgccgagctcagcaagacgctgggc
aagctctggagacttctgaacgagagcgagaagcggcccttcgtggaggaggcggagcgg
ctgcgcgtgcagcacaagaaggaccacccggattacaagtaccagccgcggcggaggaag
tcggtgaagaacgggcaggcggaggcagaggaggccacggagcagacgcacatctccccc
aacgccatcttcaaggcgctgcaggccgactcgccacactcctcctccggcatgagcgag
gtgcactcccccggcgagcactcggggcaatcccagggcccaccgaccccacccaccacc
cccaaaaccgacgtgcagccgggcaaggctgacctgaagcgagaggggcgccccttgcca
gaggggggcagacagccccctatcgacttccgcgacgtggacatcggcgagctgagcagc
gacgtcatctccaacatcgagaccttcgatgtcaacgagtttgaccagtacctgccgccc
aacggccacccgggggtgccggccacgcacggccaggtcacctacacgggcagctacggc
atcagcagcaccgcggccaccccggcgagcgcgggccacgtgtggatgtccaagcagcag
gcgccgccgccacccccgcagcagcccccacaggccccgccggccccgcaggcgcccccg
cagccgcaggcggcgcccccacagcagccggcggcacccccgcagcagccacaggcgcac
acgctgaccacgctgagcagcgagccgggccagtcccagcgaacgcacatcaagacggag
cagctgagccccagccactacagcgagcagcagcagcactcgccccaacagatcgcctac
agccccttcaacctcccacactacagcccctcctacccgcccatcacccgctcacagtac
gactacaccgaccaccagaactccagctcctactacagccacgcggcaggccagggcacc
ggcctctactccaccttcacctacatgaaccccgctcagcgccccatgtacacccccatc
gccgacacctctggggtcccttccatcccgcagacccacagcccccagcactgggaacaa
cccgtctacacacagctcactcgaccttga

Protein Sequence

>6662 : length: 509
MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDL
KKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAAR
RKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRK
SVKNGQAEAEEATEQTHISPNAIFKALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTT
PKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPP
NGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPP
QPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY
SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPI
ADTSGVPSIPQTHSPQHWEQPVYTQLTRP



')