Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6651

Name

SON

Synonym

BASS1|C21orf50|DBP-5|NREBP|SON3;SON DNA binding protein;SON;SON DNA binding protein

Definition

Bax antagonist selected in Saccharomyces 1|NRE-binding protein|negative regulatory element-binding protein|protein DBP-5|protein SON

Position

21q22.1-q22.2|21q22.11

Gene Type

protein-coding

External Links

Links to Entrez Gene

6651

Links to all GeneRIF Items

6651

Links to iHOP

6651

Sequence Information

Nucleotide Sequence

>6651 : length: 6912
atggcgaccaacatcgagcagatttttaggtctttcgtggtcagtaaattccgggaaatt
caacaggagctttccagtggaaggaatgaaggccagctgaatggtgaaacaaatacaccc
attgaaggaaaccaggcgggtgatgcagctgcctctgccaggagtctaccaaatgaagaa
atagtgcagaagatagaggaagtactttctggggtcttagatacagaactacgatataag
ccagacttgaaagagggctccagaaaaagtagatgcgtatctgtacaaacagatcctact
gatgaaattcccactaaaaagtcaaagaagcataaaaagcacaaaaacaaaaagaagaaa
aagaagaaagaaaaggaaaaaaaatataaaagacagccagaagaatctgagtcaaagacg
aaatctcatgatgatgggaacatagatttagaatctgattcctttttaaagtttgattct
gaaccttcagctgtggcgctggagcttcctacaagagcatttggcccatctgagaccaat
gaatcccctgcagttgtgctagaacctcctgtagtatcaatggaggtatcagagccacac
atcttagaaactctgaagccagctacaaaaactgcagaactgtcagttgtatctacatca
gtaatctcagagcagtcagagcagtctgtggcagtaatgccagaaccatccatgacaaag
attctggattcctttgcagcagcaccagtgcctactacaacactggtgttgaagtcatct
gagccagttgtaacaatgtcagtggagtatcagatgaagtctgtgctgaaatctgtggag
agcacatctccagagccatcaaagatcatgttggtagagcccccagtagcaaaagtgtta
gagccttcagaaacccttgtggtatcatcagagacacctactgaggtgtaccctgagcca
agcacatcaacaacaatggattttccagagtcatctgcaattgaagcgctaagattgcca
gagcagcctgtagacgtaccatcggagattgcagattcatccatgacaagaccgcaggag
ttgccggagctgcctaagaccacagcgttggagctgcaggagtcgtcggtggcctcagcg
atggagttgccggggccacctgcgacctccatgccggagttgcaggggccccctgtgact
ccagtgctggagttacctgggccctctgctaccccggtgccagagttgccagggcccctt
tctaccccagtgcctgagttgccagggccccctgcgacagcagtgcctgagttgccaggg
ccctctgtgacaccagtgccacagttgtcgcaggaattgccagggcttccagcaccatcc
atggggttggagccaccacaggaggtaccagagccacctgtgatggcacaggagttgcca
gggctgcctttggtgacagcagcagtagagttgccagagcagcctgcggtaacagtagca
atggagttgaccgaacaacctgtgacgacgacagagttggagcagcctgtggggatgaca
acggtggaacatcctgggcatcctgaggtgacaacggcaacagggttgctggggcagcct
gaggcaacgatggtgctggagttgccaggacagccagtggcaacgacagcgctggagttg
ccggggcagccttcggtgactggggtgccagagttgccagggctgccttcggcaactagg
gcactggagttgtcggggcagcctgtggcaactggggcactagagttgcctgggccgctc
atggcagctggggcactggagttctcggggcagtctggggcagctggagcactggagctt
ttggggcagcctctggcaacaggggtgctggagttgccagggcagcctggggcgccagag
ttgcctgggcagcctgtggcaactgtggcgctggagatctctgttcagtctgtggtgaca
acatcggagctgtcaacgatgaccgtgtcgcagtccctggaggtgccctcgacgacagcg
ctggaatcctataatacggtagcacaggagctgcctactacattagtgggggagacttct
gtaacagtaggagtggatcccttgatggccccagaatcccatatattagcttctaacacc
atggagacccatatattagcatccaacaccatggactcccaaatgctagcgtccaacacc
atggactcccagatgctagcatccaacaccatggactcccagatgttagcgtctagcacc
atggactcccagatgttagcaactagctccatggactcccagatgttagcaactagctcc
atggactcccagatgttagcaactagcactatggactcccagatgttagcaaccagttcc
atggactcccagatgttagcaaccagctccatggactcccagatgttagcaaccagctcc
atggactcccagatgttagcaaccagctccatggactcccagatgttagcaaccagcacc
atggattctcagatgttagcaaccagcaccatggactcccagatgttagcaactagctca
atggattcccagatgttagcatctggcactatggactctcaaatgttagcttctggcacc
atggatgctcagatgttagcgtctggtaccatggatgcccagatgttagcgtctagtacc
caagattctgctatgttgggttcaaaatctcctgatccctataggttagctcaggatcct
tacaggttagctcaggatccctataggttgggccatgacccctatagattaggtcatgat
gcttacaggttaggacaagacccttatagattaggccatgatccctacagactaactcct
gatccctataggatgtcacctagaccctacaggatagcacccaggtcctatagaatagca
cccaggccatataggttagcacctagacccctgatgttagcatctagacgttctatgatg
atgtcctatgctgcagaacgttccatgatgtcatcttacgaacgctctatgatgtcttat
gagcggtctatgatgtcccctatggctgaacgctctatgatgtcagcctacgagcgctct
atgatgtcagcctacgagcgctctatgatgtcccctatggctgagcgctctatgatgtca
gcttatgaacgctccatgatgtcagcttatgaacgctccatgatgtccccaatggctgat
cgatctatgatgtccatgggtgctgaccggtctatgatgtcgtcatactctgctgctgac
cggtctatgatgtcatcgtactctgcagctgaccgatctatgatgtcatcttatactgct
gatcgttcaatgatgtctatggctgctgattcttacaccgattcttacactgacacatat
acagaggcatatatggtgccacctttgcctcctgaagagcccccaacaatgccaccgttg
ccacctgaggagccaccaatgacaccaccattgcctcctgaggaaccaccagagggtcca
gcattgcccactgagcagtcagcattaacagctgaaaatacttggcctacagaggtgcca
tcatcaccatctgaagagtctgtatcgcagcctgagcctcctgtgagtcaaagtgagatt
tcggagccttcagcagtgcctactgattattcagtgtcagcatcagatccctcagtttta
gtatcagaggctgctgtgactgttccagaaccaccaccagagccagaatcttcaattacg
ttaacacctgtagagtctgcagtagtagcagaagaacatgaagttgttccagagagacca
gtgacttgtatggtatctgaaactcccgccatgtcagctgaaccaactgtgttagcatca
gagcctcctgttatgtcagagacagcagaaacatttgattccatgagagcctcaggacat
gttgcctcagaagtatctacatccttgttggttccagcagtaactactccagtgctggca
gagagcattctggagccgccagccatggctgccccagagtcttcagctatggctgtcctg
gagtcttcggctgtgaccgtcctggagtcttcgactgtgactgtcctggagtcttcgact
gtaactgtcctggagccttcggttgtgactgtcccggagcctcctgttgtggctgagcca
gactatgttaccattcctgtgccagttgtttctgcgctggagccttctgtgcctgttctg
gaaccagcggtgtcagtccttcaaccttctatgattgtttcagaaccatctgtttctgtc
caggaatcgactgtgacagtttcagagcctgctgtcacagtctcagagcagactcaagta
ataccaactgaggtggctatagagtccacaccaatgatactggaatctagtatcatgtca
tcacatgttatgaaaggaattaatctatcctctggtgatcaaaatcttgctccagagatt
ggcatgcaggagattgcattgcattcaggtgaagaaccacatgctgaggaacacctgaaa
ggtgacttttacgaaagtgaacatggtataaatatagaccttaatataaataatcattta
attgctaaagagatggaacataatacagtgtgtgctgctggtactagtcctgttggggaa
attggtgaagagaaaattttgcccaccagtgagactaaacagcgcacagtattggatacc
taccctggtgttagtgaagctgatgcaggagaaactctatcttctactggtccttttgct
ctggaacctgatgcaacaggaactagtaagggtattgaatttaccacagcatctactctc
agtttagttaataaatatgatgttgatttatctttaactactcaagatactgaacatgac
atggtaatttccaccagtcctagtggtggtagtgaagctgacattgaagggcctttgcct
gctaaagatattcatcttgatttaccatctaataataaccttgttagtaaggatacagaa
gaaccattacctgtaaaagagagtgaccagacattagcagctctgctcagccctaaagaa
agtagtggaggagaaaaagaagtacctccccctcctaaagagacactgcctgattcagga
ttttctgccaatattgaggatattaatgaagcagatttagtgagaccgttacttcctaag
gacatggaacgtcttacaagccttagagctggcattgaaggacctttacttgcaagtgat
gttggacgtgacagatctgctgccagcccggttgtaagtagtatgccagaaagagcttca
gagtcttcttcagaggaaaaagatgattatgaaatttttgtaaaagttaaggacactcac
gaaaaaagcaagaaaaataagaaccgtgataagggggagaaagagaagaaaagagactct
tcattaagatctcgaagtaagcgttccaaatcttctgaacacaaatcacgcaagcgtacc
agtgaatctcgttctagggcaagaaagagatcatctaagtccaagtctcatcgctctcag
acacgttcacggtcacgttcaagacgcaggaggagaagcagcagatcaagatcaaagtct
agaggaagaagatctgtatcaaaagagaagcgcaaaagatctccaaagcacagatccaag
tctagggaaagaaaaagaaaaagatcaagctccagggataaccgaaagacagttagagct
cgaagtcgaaccccaagtcgtcggagtcggagtcatactccaagtcgtcgacgaaggtct
agatctgtgggtagaagaaggagctttagcatttccccaagccgccgcagccgcaccccc
agccgccgcagccgcacccccagccgccgcagccgcacccccagccgccgcagccgcacc
cccagccgccggagccgcacccctagccgtcggagccgcaccccaagccgccggagaaga
tcaaggtctgtggtaagaagacgaagcttcagtatctcaccagtcagattaaggcgatca
agaacacccttaagaagaaggtttagcagatctcccatccgtcgtaaaagatccaggtct
tctgaacgaggcagatcacccaaacgtctgacagatttggataaggctcaattacttgaa
atagccaaagctaatgcagctgccatgtgtgctaaggctggtgtccctttaccaccaaac
ctaaagcctgcacctccacctactatagaagagaaagttgctaaaaagtcaggaggagct
actatagaagaactaactgagaaatgtaaacagatcgcacagagtaaagaagatgatgat
gtaatagtgaataaacctcatgtttcggatgaagaggaagaagaacctcctttttatcat
catccctttaaactcagtgaacccaaacctatttttttcaatctgaatattgctgcagca
aaaccaactccaccaaaaagccaggtaacattaacaaaagaattccctgtatcatctgga
tctcaacatcggaaaaaagaagcggatagtgtttatggagaatgggttcctgtggagaaa
aatggtgaagaaaacaaagatgatgataatgttttcagcagcaatttgccctcagagggc
cgggttaaacggcagggccgggttagacgacagatgaaacaacccgcagcttctcatttg
acagtaactcgatgcaattcactttgtggaaccaagccacaaagtgaaaagcatcgaatt
gcagagaacagtgttatcacatccctacccaacattgggccctccctgcacttgtgggaa
ggtagtccaaggtacaactatttagcttcccgatttgcttcaaggctctatagctctaga
ttttggtggtag

Protein Sequence

>6651 : length: 2303
MATNIEQIFRSFVVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEE
IVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKK
KKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETN
ESPAVVLEPPVVSMEVSEPHILETLKPATKTAELSVVSTSVISEQSEQSVAVMPEPSMTK
ILDSFAAAPVPTTTLVLKSSEPVVTMSVEYQMKSVLKSVESTSPEPSKIMLVEPPVAKVL
EPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQE
LPELPKTTALELQESSVASAMELPGPPATSMPELQGPPVTPVLELPGPSATPVPELPGPL
STPVPELPGPPATAVPELPGPSVTPVPQLSQELPGLPAPSMGLEPPQEVPEPPVMAQELP
GLPLVTAAVELPEQPAVTVAMELTEQPVTTTELEQPVGMTTVEHPGHPEVTTATGLLGQP
EATMVLELPGQPVATTALELPGQPSVTGVPELPGLPSATRALELSGQPVATGALELPGPL
MAAGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVT
TSELSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAPESHILASNT
METHILASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSSMDSQMLATSS
MDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATST
MDSQMLATSTMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASST
QDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTP
DPYRMSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSY
ERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAD
RSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTADRSMMSMAADSYTDSYTDTY
TEAYMVPPLPPEEPPTMPPLPPEEPPMTPPLPPEEPPEGPALPTEQSALTAENTWPTEVP
SSPSEESVSQPEPPVSQSEISEPSAVPTDYSVSASDPSVLVSEAAVTVPEPPPEPESSIT
LTPVESAVVAEEHEVVPERPVTCMVSETPAMSAEPTVLASEPPVMSETAETFDSMRASGH
VASEVSTSLLVPAVTTPVLAESILEPPAMAAPESSAMAVLESSAVTVLESSTVTVLESST
VTVLEPSVVTVPEPPVVAEPDYVTIPVPVVSALEPSVPVLEPAVSVLQPSMIVSEPSVSV
QESTVTVSEPAVTVSEQTQVIPTEVAIESTPMILESSIMSSHVMKGINLSSGDQNLAPEI
GMQEIALHSGEEPHAEEHLKGDFYESEHGINIDLNINNHLIAKEMEHNTVCAAGTSPVGE
IGEEKILPTSETKQRTVLDTYPGVSEADAGETLSSTGPFALEPDATGTSKGIEFTTASTL
SLVNKYDVDLSLTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSNNNLVSKDTE
EPLPVKESDQTLAALLSPKESSGGEKEVPPPPKETLPDSGFSANIEDINEADLVRPLLPK
DMERLTSLRAGIEGPLLASDVGRDRSAASPVVSSMPERASESSSEEKDDYEIFVKVKDTH
EKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSEHKSRKRTSESRSRARKRSSKSKSHRSQ
TRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTVRA
RSRTPSRRSRSHTPSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRT
PSRRSRTPSRRSRTPSRRRRSRSVVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS
SERGRSPKRLTDLDKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGA
TIEELTEKCKQIAQSKEDDDVIVNKPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLNIAAA
KPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEENKDDDNVFSSNLPSEG
RVKRQGRVRRQMKQPAASHLTVTRCNSLCGTKPQSEKHRIAENSVITSLPNIGPSLHLWE
GSPRYNYLASRFASRLYSSRFWW



')