Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6615

Name

SNAI1

Synonym

SLUGH2|SNA|SNAH|SNAIL|SNAIL1|dJ710H13.1;snail homolog 1 (Drosophila);SNAI1;snail homolog 1 (Drosophila)

Definition

protein sna|protein snail homolog 1|snail 1 homolog|snail 1 zinc finger protein|snail 1, zinc finger protein|zinc finger protein SNAI1

Position

20q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Cancer;FunDO

Disease

Skin disease;FunDO

Disease

Oral cancer;FunDO

External Links

Links to Entrez Gene

6615

Links to all GeneRIF Items

6615

Links to iHOP

6615

Sequence Information

Nucleotide Sequence

>6615 : length: 795
atgccgcgctctttcctcgtcaggaagccctccgaccccaatcggaagcctaactacagc
gagctgcaggactctaatccagagtttaccttccagcagccctacgaccaggcccacctg
ctggcagccatcccacctccggagatcctcaaccccaccgcctcgctgccaatgctcatc
tgggactctgtcctggcgccccaagcccagccaattgcctgggcctcccttcggctccag
gagagtcccagggtggcagagctgacctccctgtcagatgaggacagtgggaaaggctcc
cagccccccagcccaccctcaccggctccttcgtccttctcctctacttcagtctcttcc
ttggaggccgaggcctatgctgccttcccaggcttgggccaagtgcccaagcagctggcc
cagctctctgaggccaaggatctccaggctcgaaaggccttcaactgcaaatactgcaac
aaggaatacctcagcctgggtgccctcaagatgcacatccgaagccacacgctgccctgc
gtctgcggaacctgcgggaaggccttctctaggccctggctgctacaaggccatgtccgg
acccacactggcgagaagcccttctcctgtccccactgcagccgtgccttcgctgaccgc
tccaacctgcgggcccacctccagacccactcagatgtcaagaagtaccagtgccaggcg
tgtgctcggaccttctcccgaatgtccctgctccacaagcaccaagagtccggctgctca
ggatgtccccgctga

Protein Sequence

>6615 : length: 264
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR



')