Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

655

Name

BMP7

Synonym

OP-1;bone morphogenetic protein 7;BMP7;bone morphogenetic protein 7

Definition

BMP-7|osteogenic protein 1

Position

20q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

ALK2 signaling events;PID Curated;200138

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Disease

Response to citalopram treatment;NHGRI

Disease

Diabetes mellitus;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

Ankylosis;FunDO

Disease

Osteoporosis;FunDO

Disease

PHARMACOGENOMIC;GAD

Disease

Cancer;FunDO

Disease

response to citalopram treatment;GAD

Disease

Cirrhosis;FunDO

Disease

Hypertension, Pulmonary;FunDO

Disease

Arthritis;FunDO

External Links

Links to Entrez Gene

655

Links to all GeneRIF Items

655

Links to iHOP

655

Sequence Information

Nucleotide Sequence

>655 : length: 1296
atgcacgtgcgctcactgcgagctgcggcgccgcacagcttcgtggcgctctgggcaccc
ctgttcctgctgcgctccgccctggccgacttcagcctggacaacgaggtgcactcgagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgcgagatcctctcc
attttgggcttgccccaccgcccgcgcccgcacctccagggcaagcacaactcggcaccc
atgttcatgctggacctgtacaacgccatggcggtggaggagggcggcgggcccggcggc
cagggcttctcctacccctacaaggccgtcttcagtacccagggcccccctctggccagc
ctgcaagatagccatttcctcaccgacgccgacatggtcatgagcttcgtcaacctcgtg
gaacatgacaaggaattcttccacccacgctaccaccatcgagagttccggtttgatctt
tccaagatcccagaaggggaagctgtcacggcagccgaattccggatctacaaggactac
atccgggaacgcttcgacaatgagacgttccggatcagcgtttatcaggtgctccaggag
cacttgggcagggaatcggatctcttcctgctcgacagccgtaccctctgggcctcggag
gagggctggctggtgtttgacatcacagccaccagcaaccactgggtggtcaatccgcgg
cacaacctgggcctgcagctctcggtggagacgctggatgggcagagcatcaaccccaag
ttggcgggcctgattgggcggcacgggccccagaacaagcagcccttcatggtggctttc
ttcaaggccacggaggtccacttccgcagcatccggtccacggggagcaaacagcgcagc
cagaaccgctccaagacgcccaagaaccaggaagccctgcggatggccaacgtggcagag
aacagcagcagcgaccagaggcaggcctgtaagaagcacgagctgtatgtcagcttccga
gacctgggctggcaggactggatcatcgcgcctgaaggctacgccgcctactactgtgag
ggggagtgtgccttccctctgaactcctacatgaacgccaccaaccacgccatcgtgcag
acgctggtccacttcatcaacccggaaacggtgcccaagccctgctgtgcgcccacgcag
ctcaatgccatctccgtcctctacttcgatgacagctccaacgtcatcctgaagaaatac
agaaacatggtggtccgggcctgtggctgccactag

Protein Sequence

>655 : length: 431
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH



')