Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

652

Name

BMP4

Synonym

BMP2B|BMP2B1|MCOPS6|OFC11|ZYME;bone morphogenetic protein 4;BMP4;bone morphogenetic protein 4

Definition

BMP-2B|BMP-4|bone morphogenetic protein 2B

Position

14q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

Glypican 3 network;PID Curated;200193

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Hypertension;FunDO

Disease

Colorectal cancer;NHGRI

Disease

Diabetes mellitus;FunDO

Disease

Microphthalmia, syndromic 6;OMIM

Disease

Parkinson's disease;GAD

Disease

Spinal dysraphism;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Parkinson's disease;NHGRI

Disease

Cleft palate;FunDO

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Orofacial cleft 11;OMIM

Disease

NEUROLOGICAL;GAD

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

652

Links to all GeneRIF Items

652

Links to iHOP

652

Sequence Information

Nucleotide Sequence

>652 : length: 1227
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgcccgcagcctagcaagagtgccgtcattccg
gactacatgcgggatctttaccggcttcagtctggggaggaggaggaagagcagatccac
agcactggtcttgagtatcctgagcgcccggccagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggaccagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatccctgagaacgaggtgatctcctctgcagagcttcggctc
ttccgggagcaggtggaccagggccctgattgggaaaggggcttccaccgtataaacatt
tatgaggttatgaagcccccagcagaagtggtgcctgggcacctcatcacacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccctgcg
gtccttcgctggacccgggagaagcagccaaactatgggctagccattgaggtgactcac
ctccatcagactcggacccaccagggccagcatgtcaggattagccgatcgttacctcaa
gggagtgggaattgggcccagctccggcccctcctggtcacctttggccatgatggccgg
ggccatgccttgacccgacgccggagggccaagcgtagccctaagcatcactcacagcgg
gccaggaagaagaataagaactgccggcgccactcgctctatgtggacttcagcgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagtgcc
atctccatgctgtacctggatgagtatgataaggtggtactgaaaaattatcaggagatg
gtagtagagggatgtgggtgccgctga

Protein Sequence

>652 : length: 408
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR



')