Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

650

Name

BMP2

Synonym

BDA2|BMP2A;bone morphogenetic protein 2;BMP2;bone morphogenetic protein 2

Definition

BMP-2A|bone morphogenetic protein 2A

Position

20p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by BMP;PID Reactome;500592

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Signaling by BMP;Reactome;REACT:12034

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

BMP Signalling Pathway;BioCyc;PWY66-11

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Disease

Height;NHGRI

Disease

DEVELOPMENTAL;GAD

Disease

Gouts;FunDO

Disease

Amnionitis;FunDO

Disease

Ankylosis;FunDO

Disease

Osteoporosis;FunDO

Disease

Body mass index;GAD

Disease

Body mass index;NHGRI

Disease

HFE hemochromatosis, modifier of;OMIM

Disease

Cancer;FunDO

Disease

METABOLIC;GAD

Disease

iron burden;GAD

Disease

height;GAD

Disease

Hypertension, Pulmonary;FunDO

External Links

Links to Entrez Gene

650

Links to all GeneRIF Items

650

Links to iHOP

650

Sequence Information

Nucleotide Sequence

>650 : length: 1191
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

Protein Sequence

>650 : length: 396
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR



')