Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6495

Name

SIX1

Synonym

BOS3|DFNA23|TIP39;SIX homeobox 1;SIX1;SIX homeobox 1

Definition

homeobox protein SIX1|sine oculis homeobox homolog 1

Position

14q23.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

6495

Links to all GeneRIF Items

6495

Links to iHOP

6495

Sequence Information

Nucleotide Sequence

>6495 : length: 855
atgtcgatgctgccgtcgtttggctttacgcaggagcaagtggcgtgcgtgtgcgaggtt
ctgcagcaaggcggaaacctggagcgcctgggcaggttcctgtggtcactgcccgcctgc
gaccacctgcacaagaacgagagcgtactcaaggccaaggcggtggtcgccttccaccgc
ggcaacttccgtgagctctacaagatcctggagagccaccagttctcgcctcacaaccac
cccaaactgcagcaactgtggctgaaggcgcattacgtggaggccgagaagctgcgcggc
cgacccctgggcgccgtgggcaaatatcgggtgcgccgaaaatttccactgccgcgcacc
atctgggacggcgaggagaccagctactgcttcaaggagaagtcgaggggtgtcctgcgg
gagtggtacgcgcacaatccctacccatcgccgcgtgagaagcgggagctggccgaggcc
accggcctcaccaccacccaggtcagcaactggtttaagaaccggaggcaaagagaccgg
gccgcggaggccaaggaaagggagaacaccgaaaacaataactcctcctccaacaagcag
aaccaactctctcctctggaagggggcaagccgctcatgtccagctcagaagaggaattc
tcacctccccaaagtccagaccagaactcggtccttctgctgcagggcaatatgggccac
gccaggagctcaaactattctctcccgggcttaacagcctcgcagcccagtcacggcctg
cagacccaccagcatcagctccaagactctctgctcggccccctcacctccagtctggtg
gacttggggtcctaa

Protein Sequence

>6495 : length: 284
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS



')