Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6493

Name

SIM2

Synonym

HMC13F06|HMC29C01|SIM|bHLHe15;single-minded homolog 2 (Drosophila);SIM2;single-minded homolog 2 (Drosophila)

Definition

class E basic helix-loop-helix protein 15|single-minded homolog 2|single-minded homolog 2, short isoform|transcription factor SIM2

Position

21q22.2|21q22.13

Gene Type

protein-coding

External Links

Links to Entrez Gene

6493

Links to all GeneRIF Items

6493

Links to iHOP

6493

Sequence Information

Nucleotide Sequence

>6493 : length: 2004
atgaaggagaagtccaagaatgcggccaagaccaggagggagaaggaaaatggcgagttt
tacgagcttgccaagctgctcccgctgccgtcggccatcacttcgcagctggacaaagcg
tccatcatccgcctcaccacgagctacctgaagatgcgcgccgtcttccccgaaggttta
ggagacgcgtggggacagccgagccgcgccgggcccctggacggcgtcgccaaggagctg
ggatcgcacttgctgcagactttggatggatttgtttttgtggtagcatctgatggcaaa
atcatgtatatatccgagaccgcttctgtccatttaggcttatcccaggtggagctcacg
ggcaacagtatttatgaatacatccatccttctgaccacgatgagatgaccgctgtcctc
acggcccaccagccgctgcaccaccacctgctccaagagtatgagatagagaggtcgttc
tttcttcgaatgaaatgtgtcttggcgaaaaggaacgcgggcctgacctgcagcggatac
aaggtcatccactgcagtggctacttgaagatcaggcagtatatgctggacatgtccctg
tacgactcctgctaccagattgtggggctggtggccgtgggccagtcgctgccacccagt
gccatcaccgagatcaagctgtacagtaacatgttcatgttcagggccagccttgacctg
aagctgatattcctggattccagggtgaccgaggtgacggggtacgagccgcaggacctg
atcgagaagaccctataccatcacgtgcacggctgcgacgtgttccacctccgctacgca
caccacctcctgttggtgaagggccaggtcaccaccaagtactaccggctgctgtccaag
cggggcggctgggtgtgggtgcagagctacgccaccgtggtgcacaacagccgctcgtcc
cggccccactgcatcgtgagtgtcaattatgtactcacggagattgaatacaaggaactt
cagctgtccctggagcaggtgtccactgccaagtcccaggactcctggaggaccgccttg
tctacctcacaagaaactaggaaattagtgaaacccaaaaataccaagatgaagacaaag
ctgagaacaaacccttaccccccacagcaatacagctcgttccaaatggacaaactggaa
tgcggccagctcggaaactggagagccagtccccctgcaagcgctgctgctcctccagaa
ctgcagccccactcagaaagcagtgaccttctgtacacgccatcctacagcctgcccttc
tcctaccattacggacacttccctctggactctcacgtcttcagcagcaaaaagccaatg
ttgccggccaagttcgggcagccccaaggatccccttgtgaggtggcacgctttttcctg
agcacactgccagccagcggtgaatgccagtggcattatgccaaccccctagtgcctagc
agctcgtctccagctaaaaatcctccagagccaccggcgaacactgctaggcacagcctg
gtgccaagctacgaagcgcccgccgccgccgtgcgcaggttcggcgaggacaccgcgccc
ccgagcttcccgagctgcggccactaccgcgaggagcccgcgctgggcccggccaaagcc
gcccgccaggccgcccgggacggggcgcggctggcgctggcccgcgcggcacccgagtgc
tgcgcgcccccgacccccgaggccccgggcgcgccggcgcagctgcccttcgtgctgctc
aactaccaccgcgtgctggcccggcgcggaccgctggggggcgccgcacccgccgcctcc
ggcctggcctgcgctcccggcggccccgaggcggcgaccggcgcgctgcggctccggcac
ccgagccccgccgccacctccccgcccggcgcgcccctgccgcactacctgggcgcctcg
gtcatcatcaccaacgggaggtga

Protein Sequence

>6493 : length: 667
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLYSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTAKSQDSWRTAL
STSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE
LQPHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFL
STLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAP
PSFPSCGHYREEPALGPAKAARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLL
NYHRVLARRGPLGGAAPAASGLACAPGGPEAATGALRLRHPSPAATSPPGAPLPHYLGAS
VIITNGR



')