Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

648

Name

BMI1

Synonym

FLVI2/BMI1|PCGF4|RNF51;BMI1 polycomb ring finger oncogene;BMI1;BMI1 polycomb ring finger oncogene

Definition

B lymphoma Mo-MLV insertion region 1 homolog|flvi-2/bmi-1|murine leukemia viral (bmi-1) oncogene homolog|polycomb complex protein BMI-1|polycomb group RING finger protein 4|polycomb group protein Bmi1|ring finger protein 51

Position

10p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

the prc2 complex sets long-term gene silencing through modification of histone tails;PID BioCarta;100063

Disease

Primary biliary cirrhosis;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

External Links

Links to Entrez Gene

648

Links to all GeneRIF Items

648

Links to iHOP

648

Sequence Information

Nucleotide Sequence

>648 : length: 981
atgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaagaccagaccactactgaatataaggtcagataaaactctccaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccttta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgacaaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

Protein Sequence

>648 : length: 326
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG



')