Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6469

Name

SHH

Synonym

HHG1|HLP3|HPE3|MCOPCB5|SMMCI|TPT|TPTPS;sonic hedgehog;SHH;sonic hedgehog

Definition

sonic hedgehog homolog|sonic hedgehog protein

Position

7q36

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Pathway

Glypican 3 network;PID Curated;200193

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

sonic hedgehog receptor ptc1 regulates cell cycle;PID BioCarta;100060

Disease

Drug abuse;FunDO

Disease

Microphthalmia, isolated, with coloboma 5;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Hamman-Rich syndrome;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Platelet aggregation;NHGRI

Disease

Holoprosencephaly-3;OMIM

Disease

Coloboma, ocular;OMIM

Disease

Multiple sclerosis;FunDO

Disease

Basal cell carcinoma;KEGG DISEASE;H00039

Disease

Congenital abnormality;FunDO

Disease

Gastritis;FunDO

Disease

Cancer;FunDO

Disease

Skin cancers;KEGG DISEASE

Disease

Solitary median maxillary central incisor;OMIM

External Links

Links to Entrez Gene

6469

Links to all GeneRIF Items

6469

Links to iHOP

6469

Sequence Information

Nucleotide Sequence

>6469 : length: 1389
atgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctggtatgctcg
ggactggcgtgcggaccgggcagggggttcgggaagaggaggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggcgccagcgga
aggtatgaagggaagatctccagaaactccgagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacaccggagcggacaggctgatgactcag
aggtgtaaggacaagttgaacgctttggccatctcggtgatgaaccagtggccaggagtg
aaactgcgggtgaccgagggctgggacgaagatggccaccactcagaggagtctctgcac
tacgagggccgcgcagtggacatcaccacgtctgaccgcgaccgcagcaagtacggcatg
ctggcccgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaggcacat
atccactgctcggtgaaagcagagaactcggtggcggccaaatcgggaggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggacctgagcccc
ggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgacttcctcact
ttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgggagccg
cgcgagcgcctgctgctcaccgccgcgcacctgctctttgtggcgccgcacaacgactcg
gccaccggggagcccgaggcgtcctcgggctcggggccgccttccgggggcgcactgggg
cctcgggcgctgttcgccagccgcgtgcgcccgggccagcgcgtgtacgtggtggccgag
cgtgacggggaccgccggctcctgcccgccgctgtgcacagcgtgaccctaagcgaggag
gccgcgggcgcctacgcgccgctcacggcccagggcaccattctcatcaaccgggtgctg
gcctcgtgctacgcggtcatcgaggagcacagctgggcgcaccgggccttcgcgcccttc
cgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgcggcggggac
agcggcggcggggaccgcgggggcggcggcggcagagtagccctaaccgctccaggtgct
gccgacgctccgggtgcgggggccaccgcgggcatccactggtactcgcagctgctctac
caaataggcacctggctcctggacagcgaggccctgcacccgctgggcatggcggtcaag
tccagctga

Protein Sequence

>6469 : length: 462
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS



')