Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6440

Name

SFTPC

Synonym

PSP-C|SFTP2|SMDP2|SP-C;surfactant protein C;SFTPC;surfactant protein C

Definition

SP5|pulmonary surfactant apoprotein-2 SP-C|pulmonary surfactant-associated protein C|pulmonary surfactant-associated proteolipid SPL(Val)

Position

8p21

Gene Type

protein-coding

External Links

Links to Entrez Gene

6440

Links to all GeneRIF Items

6440

Links to iHOP

6440

Sequence Information

Nucleotide Sequence

>6440 : length: 576
atggatgtgggcagcaaagaggtcctgatggagagcccgccggactactccgcagctccc
cggggccgatttggcattccctgctgcccagtgcacctgaaacgccttcttatcgtggtg
gtggtggtggtcctcatcgtcgtggtgattgtgggagccctgctcatgggtctccacatg
agccagaaacacacggagatggttctggagatgagcattggggcgccggaagcccagcaa
cgcctggccctgagtgagcacctggttaccactgccaccttctccatcggctccactggc
ctcgtggtgtatgactaccagcagctgctgatcgcctacaagccagcccctggcacctgc
tgctacatcatgaagatagctccagagagcatccccagtcttgaggctctcactagaaaa
gtccacaacttccaggccaagcccgcagtgcctacgtctaagctgggccaggcagagggg
cgagatgcaggctcagcaccctccggaggggacccggccttcctgggcatggccgtgagc
accctgtgtggcgaggtgccgctctactacatctag

Protein Sequence

>6440 : length: 191
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHM
SQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC
CYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVS
TLCGEVPLYYI



')