Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6387

Name

CXCL12

Synonym

IRH|PBSF|SCYB12|SDF1|SDF1A|SDF1B|TLSF|TPAR1;chemokine (C-X-C motif) ligand 12;CXCL12;chemokine (C-X-C motif) ligand 12

Definition

intercrine reduced in hepatomas|pre-B cell growth-stimulating factor|stromal cell-derived factor 1

Position

10q11.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Chemokine receptors bind chemokines;PID Reactome;500406

Pathway

Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672

Disease

Lupus erythematosus;FunDO

Disease

leukemia, myeloid;GAD

Disease

HEMATOLOGICAL;GAD

Disease

Coronary heart disease;NHGRI

Disease

Cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

HIV infection;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

AIDS, resistance to;OMIM

Disease

Immunologic deficiency syndrome;FunDO

Disease

IMMUNE;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

HIV;GAD

Disease

INFECTION;GAD

Disease

increased perinatal immunodeficiency virus type 1 transmission;GAD

Disease

Diabetes mellitus;FunDO

Disease

diabetes, type 1;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Multiple sclerosis;FunDO

Disease

CANCER;GAD

Disease

Coronary Disease;GAD

Disease

myocardial infarction (early onset);GAD

Disease

Behcet syndrome;FunDO

Disease

Wiskott-Aldrich syndrome;FunDO

Disease

hematopoietic progenitor cells, mobilization of;GAD

Disease

Atherosclerosis;GAD

Disease

Atherosclerosis;FunDO

Disease

Myocardial infarction (early onset);NHGRI

Disease

Arthritis;FunDO

External Links

Links to Entrez Gene

6387

Links to all GeneRIF Items

6387

Links to iHOP

6387

Sequence Information

Nucleotide Sequence

>6387 : length: 282
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

Protein Sequence

>6387 : length: 93
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM



')