Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6383

Name

SDC2

Synonym

CD362|HSPG|HSPG1|SYND2;syndecan 2;SDC2;syndecan 2

Definition

cell surface-associated heparan sulfate proteoglycan 1|fibroglycan|heparan sulfate proteoglycan 1, cell surface-associated|heparan sulfate proteoglycan core protein|syndecan proteoglycan 2|syndecan-2

Position

8q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

FGFR1b ligand binding and activation;PID Reactome;500237

Pathway

FGFR3 ligand binding and activation;PID Reactome;500243

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

FGFR3c ligand binding and activation;PID Reactome;500245

Pathway

FGFR1c ligand binding and activation;PID Reactome;500238

Pathway

FGFR2c ligand binding and activation;PID Reactome;500242

Pathway

FGFR ligand binding and activation;PID Reactome;500235

Pathway

FGFR3b ligand binding and activation;PID Reactome;500244

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Proteogylcan syndecan-mediated signaling events;PID Curated;200111

Pathway

FGFR1 ligand binding and activation;PID Reactome;500236

Pathway

FGFR2 ligand binding and activation;PID Reactome;500240

Pathway

FGFR2b ligand binding and activation;PID Reactome;500241

Pathway

FGFR4 ligand binding and activation;PID Reactome;500246

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

FGFR1c and Klotho ligand binding and activation;PID Reactome;500239

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Leukemia;FunDO

Disease

Colon cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

6383

Links to all GeneRIF Items

6383

Links to iHOP

6383

Sequence Information

Nucleotide Sequence

>6383 : length: 606
atgcggcgcgcgtggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagctgacatctgataaagacatgtaccttgacaacagctccattgaagaagct
tcaggagtgtatcctattgatgacgatgactacgcttctgcgtctggctcgggagctgat
gaggatgtagagagtccagagctgacaacatctcgaccacttccaaagatactgttgact
agtgctgctccaaaagtggaaaccacgacgctgaatatacagaacaagatacctgctcag
acaaagtcacctgaagaaactgataaagagaaagttcacctctctgactcagaaaggaaa
atggacccagccgaagaggatacaaatgtgtatactgagaaacactcagacagtctgttt
aaacggacagaagtcctagcagctgtcattgctggtggagttattggctttctctttgca
atttttcttatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagctatgac
cttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttttat
gcgtaa

Protein Sequence

>6383 : length: 201
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA



')