Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6374

Name

CXCL5

Synonym

ENA-78|SCYB5;chemokine (C-X-C motif) ligand 5;CXCL5;chemokine (C-X-C motif) ligand 5

Definition

C-X-C motif chemokine 5|ENA-78(1-78)|epithelial-derived neutrophil activating protein 78|epithelial-derived neutrophil-activating peptide 78|epithelial-derived neutrophil-activating protein 78|neutrophil-activating peptide ENA-78|neutrophil-activating pro

Position

4q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Disease

Stomach cancer;FunDO

Disease

Infection;FunDO

Disease

Inflammation of the central nervous system;FunDO

Disease

Sarcoidosis;FunDO

Disease

Endometriosis;FunDO

Disease

Colon cancer;FunDO

Disease

Temporal arteritis;FunDO

External Links

Links to Entrez Gene

6374

Links to all GeneRIF Items

6374

Links to iHOP

6374

Sequence Information

Nucleotide Sequence

>6374 : length: 345
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

Protein Sequence

>6374 : length: 114
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN



')