Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

6275

Name

S100A4

Synonym

18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98;S100 calcium binding protein A4;S100A4;S100 calcium binding protein A4

Definition

S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|fibroblast-specific protein-1|leukemia multidrug resistance associated protein|malignant transformation suppression 1|placental calcium-binding protein|pr

Position

1q21

Gene Type

protein-coding

External Links

Links to Entrez Gene

6275

Links to all GeneRIF Items

6275

Links to iHOP

6275

Sequence Information

Nucleotide Sequence

>6275 : length: 306
atggcgtgccctctggagaaggccctggatgtgatggtgtccaccttccacaagtactcg
ggcaaagagggtgacaagttcaagctcaacaagtcagaactaaaggagctgctgacccgg
gagctgcccagcttcttggggaaaaggacagatgaagctgctttccagaagctgatgagc
aacttggacagcaacagggacaacgaggtggacttccaagagtactgtgtcttcctgtcc
tgcatcgccatgatgtgtaacgaattctttgaaggcttcccagataagcagcccaggaag
aaatga

Protein Sequence

>6275 : length: 101
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK



')