Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5998

Name

RGS3

Synonym

C2PA|PDZ-RGS3|RGP3;regulator of G-protein signaling 3;RGS3;regulator of G-protein signaling 3

Definition

regulator of G-protein signalling 3

Position

9q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Ephrin B reverse signaling;PID Curated;200173

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

5998

Links to all GeneRIF Items

5998

Links to iHOP

5998

Sequence Information

Nucleotide Sequence

>5998 : length: 1809
atggagcgctccctgcaccgcgtctccctcgggagccggcgtgcccacccggacttgtcc
ttctacctcaccacctttggtcagctgaggctgtccattgatgcccaggaccgggttctg
ctgcttcacattatagaaggtaaaggcctgatcagcaaacagcctggcacctgtgatccg
tatgtgaagatttctttgatccctgaagatagtagactacgccaccagaagacgcagacc
gttccagactgcagagacccggctttccacgagcacttcttctttcctgtccaagaggag
gatgatcagaagcgtctcttggttactgtgtggaacagggccagccagtccagacagagt
ggactcattggctgcatgagctttggggtgaagtctctcctgactccagacaaggagatc
agtggttggtactacctcctaggggagcacctgggccggaccaagcacttgaaggtggcc
aggcggcgactgcggccgctgagagacccgctgctgagaatgccaggaggtggggacact
gagaatgggaagaaactaaagatcaccatcccgaggggaaaggacggctttggcttcacc
atctgctgcgactctccagttcgagtccaggccgtggattccgggggtccggcggaacgg
gcagggctgcagcagctggacacggtgctgcagctgaatgagaggcctgtggagcactgg
aaatgtgtggagctggcccacgagatccggagctgccccagtgagatcatcctactcgtg
tggcgcatggtcccccaggtcaagccaggaccagatggcggggtcctgcggcgggcctcc
tgcaagtcgacacatgacctccagtcaccccccaacaaacgggagaagaactgcacccat
ggggtccaggcacggcctgagcagcgccacagctgccacctggtatgtgacagctctgat
gggctgctgctcggcggctgggagcgctacaccgaggtggccaagcgcgggggccagcac
accctgcctgcactgtcccgtgccactgcccccaccgaccccaactacatcatcctggcc
ccgctgaatcctgggagccagctgctccggcctgtgtaccaggaggataccatccccgaa
gaatcagggagtcccagtaaagggaagtcctacacaggcctggggaagaagtcccggctg
atgaagacagtgcagaccatgaagggccacgggaactaccaaaactgcccggttgtgagg
ccgcatgccacgcactcaagctatggcacctacgtcaccctggcccccaaagtcctggtg
ttccctgtctttgttcagcctctagatctctgtaatcctgcccggaccctcctgctgtca
gaggagctgctgctgtatgaagggaggaacaaggctgccgaggtgacactgtttgcctat
tcggacctgctgctcttcaccaaggaggacgagcctggccgctgcgacgtcctgaggaac
cccctctacctccagagtgtgaagctgcaggaaggttcttcagaagacctgaaattctgc
gtgctctatctagcagagaaggcagagtgcttattcactttggaagcgcactcgcaggag
cagaagaagagagtgtgctggtgcctgtcggagaacatcgccaagcagcaacagctggca
gcatcacccccggacagcaagaaactccaccctttcggctctctccagcaggagatgggg
ccggtcaactcaaccaatgccacccaggatagaagctttacctcaccaggacagactctg
attggctga

Protein Sequence

>5998 : length: 602
MERSLHRVSLGSRRAHPDLSFYLTTFGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDP
YVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQS
GLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDT
ENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHW
KCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTH
GVQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILA
PLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVR
PHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAY
SDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQE
QKKRVCWCLSENIAKQQQLAASPPDSKKLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTL
IG



')