Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

598

Name

BCL2L1

Synonym

BCL-XL/S|BCL2L|BCLX|BCLXL|BCLXS|Bcl-X|PPP1R52|bcl-xL|bcl-xS;BCL2-like 1;BCL2L1;BCL2-like 1

Definition

apoptosis regulator Bcl-X|bcl-2-like protein 1|protein phosphatase 1, regulatory subunit 52

Position

20q11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

opposing roles of aif in apoptosis and cell survival;PID BioCarta;100249

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Disease

Autoimmune disease;FunDO

Disease

Ischemia;FunDO

Disease

Adenovirus infection;FunDO

Disease

Glaucoma;FunDO

Disease

Thyroid gland disease;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Severe acute respiratory syndrome;FunDO

Disease

Lymphopenia;FunDO

Disease

Cancer;FunDO

Disease

Parkinson disease;FunDO

Disease

Dental plaque;FunDO

Disease

Rabies;FunDO

Disease

Asthma;FunDO

Disease

HIV infection;FunDO

Disease

Neck cancer;FunDO

Disease

Polyarthritis;FunDO

External Links

Links to Entrez Gene

598

Links to all GeneRIF Items

598

Links to iHOP

598

Sequence Information

Nucleotide Sequence

>598 : length: 513
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggca
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggatacttttgtggaactctatgggaacaatgcagcagccgagagc
cgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtggccggcgtg
gttctgctgggctcactcttcagtcggaaatga

Protein Sequence

>598 : length: 170
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK



')