Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5962

Name

RDX

Synonym

DFNB24;radixin;RDX;radixin

Definition

-

Position

11q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

RhoA signaling pathway;PID Curated;200007

Disease

Congenital abnormality;FunDO

Disease

Deafness, autosomal recessive, 24;OMIM

Disease

Infection;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Deafness;FunDO

External Links

Links to Entrez Gene

5962

Links to all GeneRIF Items

5962

Links to iHOP

5962

Sequence Information

Nucleotide Sequence

>5962 : length: 1752
atgccgaaaccaatcaacgtaagagtaactacaatggatgctgagctggaatttgccatt
cagcccaatacaactggcaaacaactttttgaccaggtggtgaaaacagttggtttgcgt
gaggtctggttttttgggctgcagtatgtagacagcaaaggttattctacatggcttaaa
ctaaataaaaaggtaacacagcaggatgttaaaaaagagaatcctttacagttcaagttt
agagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagaga
ctcttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccgccagaa
actgcagttcttttggcttcctatgctgtccaagccaagtatggagattacaataaagag
attcataagccaggctacctggctaatgatagactcctaccccagcgtgtattggaacaa
cacaaactaacaaaagaacagtgggaagaaagaatacagaactggcatgaagaacataga
ggaatgttaagggaggattctatgatggaatacctgaagattgcacaagatctagaaatg
tatggagtcaactattttgaaataaaaaataaaaaaggaactgaattgtggctaggtgtt
gatgctttgggtctgaatatttatgagcatgacgacaagttaacacctaaaattggtttt
ccctggagtgaaatcagaaatatttcatttaatgacaaaaaatttgttataaagccaatc
gacaaaaaggcacctgattttgtgttttatgcacctcgtctgagaatcaataagcggatt
ttggccttatgtatgggaaaccatgaactatacatgcgaagaaggaagcctgatactatt
gaagtacaacagatgaaggctcaggctagggaggagaaacatcagaagcagttggaaagg
gcacaattagagaatgaaaagaagaaaagagaaatagcagaaaaggaaaaggaaagaata
gaacgtgaaaaggaagagctaatggaacgtctaaaacaaattgaagagcagacaattaaa
gctcagaaagaactagaagaacagactcgaaaagctctagaactggatcaagaacgaaaa
cgagcaaaagaagaagcagaacgacttgaaaaggagcgtcgagctgctgaagaggcaaag
tctgccatagcaaaacaagctgccgaccagatgaagaatcaggagcagctagcagcagaa
cttgctgaattcactgccaagattgcacttctagaggaagccaagaagaaaaaggaagag
gaagctactgagtggcaacacaaagcttttgcagcccaggaagacttggaaaagaccaaa
gaagagttaaaaactgtgatgtctgccccccctccacctccaccaccaccagtcattcct
ccaacagaaaacgaacatgatgaacacgatgagaataatgctgaagctagtgctgaatta
tcaaatgaaggggtaatgaaccatagaagcgaggaagaacgtgtaaccgaaacacagaaa
aatgagcgtgttaagaagcaacttcaggcattaagttcagaattagcccaagccagagat
gaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgat
aagtacaagactctgcgacagattcgacaaggcaatacaaagcagcgtatcgatgagttt
gaagcaatgtga

Protein Sequence

>5962 : length: 583
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM



')