Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

596

Name

BCL2

Synonym

Bcl-2|PPP1R50;B-cell CLL/lymphoma 2;BCL2;B-cell CLL/lymphoma 2

Definition

apoptosis regulator Bcl-2|protein phosphatase 1, regulatory subunit 50

Position

18q21.33|18q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

transcription regulation by methyltransferase of carm1;PID BioCarta;100220

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

Activation of BAD and translocation to mitochondria;PID Reactome;500261

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

melanocyte development and pigmentation pathway;PID BioCarta;100108

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

prion pathway;PID BioCarta;100062

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

C-MYB transcription factor network;PID Curated;200130

Disease

CANCER;GAD

Disease

Drug abuse;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Oropharyngeal Neoplasms;GAD

Disease

Brain ischemia;FunDO

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Carcinoma, Squamous Cell;GAD

Disease

Ischemia;FunDO

Disease

Eating disorder;FunDO

Disease

HIV infection;FunDO

Disease

Esotropia;FunDO

Disease

Keratosis;FunDO

Disease

Herpes;FunDO

Disease

Eye cancer;FunDO

Disease

lung cancer;GAD

Disease

IMMUNE;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Thyroid gland disease;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Dental plaque;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Stroke;FunDO

Disease

Viral infections;KEGG DISEASE

Disease

Glaucoma;FunDO

Disease

Alzheimer's disease;FunDO

Disease

leukemia/lymphoma, T-Cell;GAD

Disease

Autoimmune disease;FunDO

Disease

chronic obstructive pulmonary disease/COPD lung function;GAD

Disease

Tuberculosis;FunDO

Disease

Lichen planus;FunDO

Disease

Chronic lymphocytic leukemia (CLL);KEGG DISEASE;H00005

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Graves' disease;FunDO

Disease

Leukemia/lymphoma, B-cell, 2;OMIM

Disease

Schistosomiasis;FunDO

Disease

Hodgkin's disease;GAD

Disease

Neoplasm Recurrence, Local;GAD

Disease

Cancers;KEGG DISEASE

Disease

Lupus erythematosus;FunDO

Disease

Small cell lung cancer;KEGG DISEASE;H00013

Disease

leukemia;GAD

Disease

Cervical cancer;KEGG DISEASE;H00030

Disease

follicular lymphoma to diffuse large-cell lymphoma;GAD

Disease

Celiac disease;FunDO

Disease

Nasopharyngeal cancer;KEGG DISEASE;H00054

Disease

Congenital abnormality;FunDO

Disease

follicular lymphoma;GAD

Disease

Autistic disorder;FunDO

Disease

Head and neck cancers;KEGG DISEASE

Disease

systemic lupus erythematosus;GAD

Disease

Lupus;GAD

External Links

Links to Entrez Gene

596

Links to all GeneRIF Items

596

Links to iHOP

596

Sequence Information

Nucleotide Sequence

>596 : length: 720
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc
gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

Protein Sequence

>596 : length: 239
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK



')