Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5879

Name

RAC1

Synonym

Rac-1|TC-25|p21-Rac1;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);RAC1;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)

Definition

cell migration-inducing gene 5 protein|ras-like protein TC25|ras-related C3 botulinum toxin substrate 1

Position

7p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Axon guidance mediated by netrin;PANTHER;P00009

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

Pathway

Endothelins;PID Curated;200004

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Activation of Rac;PID Reactome;500095

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Signaling by Robo receptor;PID Reactome;500092

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Huntington disease;PANTHER;P00029

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Inactivation of Cdc42 and Rac;PID Reactome;500094

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Paxillin-dependent events mediated by a4b1;PID Curated;200117

Pathway

Arf1 pathway;PID Curated;200167

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

DCC mediated attractive signaling;PID Reactome;500089

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

B cell activation;PANTHER;P00010

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Viral myocarditis;KEGG PATHWAY;hsa05416

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

S1P1 pathway;PID Curated;200071

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

how does salmonella hijack a cell;PID BioCarta;100037

Pathway

S1P2 pathway;PID Curated;200181

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Phagosome;KEGG PATHWAY;hsa04145

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

CD28 dependent Vav1 pathway;PID Reactome;500486

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Nef and signal transduction;PID Reactome;500755

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

y branching of actin filaments;PID BioCarta;100254

Pathway

SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion;PID Reactome;500075

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Mental retardation;FunDO

Disease

Adenovirus infection;FunDO

Disease

Cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Salmonella infection;FunDO

External Links

Links to Entrez Gene

5879

Links to all GeneRIF Items

5879

Links to iHOP

5879

Sequence Information

Nucleotide Sequence

>5879 : length: 579
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccgcct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

Protein Sequence

>5879 : length: 192
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL



')